PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.TU.contig_40341.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family LBD
Protein Properties Length: 120aa    MW: 13411.6 Da    PI: 10.0968
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.TU.contig_40341.2genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26051.14e-164280139
                 DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGa 39
                           +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++F +
  evm.TU.contig_40341.2 42 PCAACKILRRRCAEKCVLAPYFPPTEPAKFTIAHRVFER 80
                           7************************************76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089112.09241119IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-144280IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 120 aa     Download sequence    Send to blast
MEYSDSNNTN TSPSSSQSLS PSSSPPPSSG LRPPVVPVVI SPCAACKILR RRCAEKCVLA  60
PYFPPTEPAK FTIAHRVFER FEWKKIKLFG RFDLGCKCFQ RFILEIFQVP YPTGKQKKN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.TU.contig_40341.2
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021910984.12e-48LOW QUALITY PROTEIN: LOB domain-containing protein 1-like
TrEMBLA0A1J7HRV02e-22A0A1J7HRV0_LUPAN; Uncharacterized protein
STRINGevm.TU.contig_40341.28e-82(Carica papaya)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-22LOB domain-containing protein 1