PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.TU.contig_40341.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family LBD
Protein Properties Length: 89aa    MW: 9858.93 Da    PI: 3.9717
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.TU.contig_40341.1genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26042.22.3e-1314161101
                 DUF260  61 lvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101
                            +vyeA ar+rdPvyG++g i +lq+q+++l+a+la++++e+
  evm.TU.contig_40341.1   1 MVYEASARIRDPVYGCAGAICQLQKQVNELQAQLAKAQAEI 41 
                            69**********************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031953.0E-11138IPR004883Lateral organ boundaries, LOB
PROSITE profilePS508919.542141IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MVYEASARIR DPVYGCAGAI CQLQKQVNEL QAQLAKAQAE ILNNNDSPQS MDMTFNVSSP  60
SYQSNLNCLF EDNNNANTTQ PLWETLWT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.TU.contig_40341.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021910984.11e-51LOW QUALITY PROTEIN: LOB domain-containing protein 1-like
SwissprotQ9LQR04e-22LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A061GTD18e-28A0A061GTD1_THECC; LOB domain-containing protein 1
STRINGevm.TU.contig_40341.13e-59(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Representative plantOGRP1626323
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.14e-17LOB domain-containing protein 1