PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.TU.contig_40189.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 121aa    MW: 13517.6 Da    PI: 9.594
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.TU.contig_40189.1genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF64.79.4e-211152344
                           --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
                 SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                           i+n+s r++tf kR++g++KKA+EL +LC+++ ++ii+ss +
  evm.TU.contig_40189.1 11 ISNESTRKTTFQKRKKGLMKKASELATLCGINMCMIIYSSYN 52
                           9**************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.834150IPR002100Transcription factor, MADS-box
SMARTSM004328.5E-23160IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-10323IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.19E-23487IPR002100Transcription factor, MADS-box
CDDcd002663.58E-29485No hitNo description
PfamPF003192.1E-191152IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-102338IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-103859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MKGRKMKLAL ISNESTRKTT FQKRKKGLMK KASELATLCG INMCMIIYSS YNTQPEVWPS  60
PSGVQSVLND FNAMSKIDQS KKMLNQELMG FGLGKMIMPM EDNDNENIEN NNNNNDNSAT  120
*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the development of gametophytes and seeds.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.TU.contig_40189.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by MEA in seeds, and by PKL after germination. {ECO:0000269|PubMed:12815071, ECO:0000269|PubMed:16359393}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021910995.13e-59agamous-like MADS-box protein AGL80
SwissprotQ7XJK82e-28PHE2_ARATH; MADS-box transcription factor PHERES 2
TrEMBLU5GF697e-34U5GF69_POPTR; Uncharacterized protein
STRINGevm.TU.contig_40189.16e-83(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.21e-30M-type_MADS family protein
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]