PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.TU.contig_38884.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 171aa    MW: 18990.1 Da    PI: 8.5277
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.TU.contig_38884.2genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF30.54.5e-10911301049
                            HHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
                 SRF-TF  10 qvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 
                            +v fs  ++ ++KK +EL++L +a++ +iifs+++k++ +
  evm.TU.contig_38884.2  91 KVIFSMCQAKLFKKMSELCTLFGADIVIIIFSPSQKVFSF 130
                            5678888899***************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-428133IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.89E-1289150IPR002100Transcription factor, MADS-box
PfamPF003192.1E-1389130IPR002100Transcription factor, MADS-box
PROSITE profilePS5006610.72289134IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MALDEDLSLA QLRQLKASLD ELKKNMVKCV EKIMIHTSNN HPHRHNHPHH PFFMGISSSG  60
ANVPFETSPA RFHSTIGPFN NPNMMPPGNL KVIFSMCQAK LFKKMSELCT LFGADIVIII  120
FSPSQKVFSF GHPSVEIVVE HFISSPPQDA SGSMKCFKAH RNTSVCELNM *
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.TU.contig_38884.2
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021911656.12e-32agamous-like MADS-box protein AGL62, partial
STRINGevm.TU.contig_38884.21e-122(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-20AGAMOUS-like 62