PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.TU.contig_36253.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 146aa    MW: 16777.1 Da    PI: 10.0604
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.TU.contig_36253.1genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF38.91.1e-121964146
                           S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
                 SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46
                           k+ en+   qvtfsk r  ++KKA+E ++L   +v +i+fs+ ++ 
  evm.TU.contig_36253.1 19 KKMENEASLQVTFSKHRSSLFKKASEPCTLYRQDVGLIVFSPGNRA 64
                           56799999*********************************98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.0E-151170IPR002100Transcription factor, MADS-box
PROSITE profilePS5006618.4741171IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.33E-191285IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-121333IPR002100Transcription factor, MADS-box
PfamPF003194.2E-152067IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-123348IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-124869IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MADEGTSSKN KGRQKIESKK MENEASLQVT FSKHRSSLFK KASEPCTLYR QDVGLIVFSP  60
GNRAFCYGNP NIDIVIDRFL SIDVRPIKIL TTTMILNKQS AQDKEEAARK RGKELKQRRK  120
GLMKELWYTH SMDKFSLEEL EVLDAX
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.TU.contig_36253.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2385901e-134AC238590.1 Carica papaya BAC clone 12I03, complete sequence.
GenBankAC2386371e-134AC238637.1 Carica papaya BAC clone 99B01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021911410.16e-77agamous-like MADS-box protein AGL62
TrEMBLA0A1S3V1E37e-35A0A1S3V1E3_VIGRR; agamous-like MADS-box protein AGL62
STRINGevm.TU.contig_30908.21e-102(Carica papaya)
STRINGevm.TU.contig_36253.11e-104(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.18e-29AGAMOUS-like 62