PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.TU.contig_35868.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 72aa    MW: 8080.69 Da    PI: 10.913
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.TU.contig_35868.1genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF49.65.2e-161150342
                           --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
                 SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                           i n+s r+ tf kR++g +KK +EL++LC +++  ii+s+
  evm.TU.contig_35868.1 11 ITNNSARKATFKKRKKGFMKKVSELCILCKVKAYAIIYSP 50
                           89************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.25149IPR002100Transcription factor, MADS-box
SMARTSM004325.3E-12160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.75E-18153IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-8323IPR002100Transcription factor, MADS-box
PfamPF003191.1E-161150IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-82338IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-83859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 72 aa     Download sequence    Send to blast
MTKKKAKVTY ITNNSARKAT FKKRKKGFMK KVSELCILCK VKAYAIIYSP MTGNQRFGLP  60
FSEPNACWPT S*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224KKKAKVTYITNNSARKATFKKRK
22125KKRKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.TU.contig_35868.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011463188.18e-17PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLA0A1S3ZJU33e-15A0A1S3ZJU3_TOBAC; agamous-like MADS-box protein AGL80
TrEMBLV4L1X36e-15V4L1X3_EUTSA; Uncharacterized protein
STRINGevm.TU.contig_35868.13e-45(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.32e-07M-type_MADS family protein