PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.TU.contig_33457.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 62aa    MW: 7188.61 Da    PI: 10.6397
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.TU.contig_33457.1genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF23.38.2e-081348843
                           HHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
                 SRF-TF  8 nrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                            r++ f kR++g++ K +EL  L d++   ii+s+ 
  evm.TU.contig_33457.1 13 TRKILFKKRKKGLMMKVSELNSLYDVKSYAIIYSPY 48
                           68899****************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.96E-12158IPR002100Transcription factor, MADS-box
SMARTSM004323.7E-5157IPR002100Transcription factor, MADS-box
PROSITE profilePS500669.769146IPR002100Transcription factor, MADS-box
PfamPF003194.7E-101348IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 62 aa     Download sequence    Send to blast
MSRKKVKFAY ITTRKILFKK RKKGLMMKVS ELNSLYDVKS YAIIYSPYDL QQEVWPSPLG  60
A*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1222RKKVKFAYITTRKILFKKRKK
21822KKRKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.TU.contig_33457.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021912469.12e-22agamous-like MADS-box protein AGL80
TrEMBLU5GF694e-17U5GF69_POPTR; Uncharacterized protein
STRINGevm.TU.contig_33457.16e-37(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.21e-15M-type_MADS family protein