PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.TU.contig_30689.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 242aa    MW: 27036 Da    PI: 10.3644
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.TU.contig_30689.1genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF74.49e-241662349
                           --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
                 SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                            +n+sn qvtfskRr+g++KKA+ELS+LC+ae+a+i+fs+++k++ +
  evm.TU.contig_30689.1 16 MNNESNLQVTFSKRRAGLFKKASELSTLCGAEIAIIVFSPSQKVFAF 62
                           689****************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.5E-32665IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.376666IPR002100Transcription factor, MADS-box
CDDcd002654.33E-34774No hitNo description
SuperFamilySSF554552.62E-26789IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-19828IPR002100Transcription factor, MADS-box
PfamPF003198.0E-251662IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-192843IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-194364IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MARKSKGRQK VEMAKMNNES NLQVTFSKRR AGLFKKASEL STLCGAEIAI IVFSPSQKVF  60
AFGHPCVQTV LERFVSGNPP QAASGTMKLI EAHRNTSVCE LNMQLTQVLN QLEIEKKRGE  120
ELNHMKKANE NQCWWMARKN DMSLTQLQQL KASLDELKKN VAKQAEKIVI HTQNNHHPHP  180
HLPHPHPHHH HPNHPFFLGS SSGGAGLPFE TKPAGFSSSI VPFNNPNMIP PQYHGFGQGF  240
F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A1e-18792186Myocyte-specific enhancer factor 2A
3kov_B1e-18792186Myocyte-specific enhancer factor 2A
3kov_I1e-18792186Myocyte-specific enhancer factor 2A
3kov_J1e-18792186Myocyte-specific enhancer factor 2A
3p57_A1e-18792186Myocyte-specific enhancer factor 2A
3p57_B1e-18792186Myocyte-specific enhancer factor 2A
3p57_C1e-18792186Myocyte-specific enhancer factor 2A
3p57_D1e-18792186Myocyte-specific enhancer factor 2A
3p57_I1e-18792186Myocyte-specific enhancer factor 2A
3p57_J1e-18792186Myocyte-specific enhancer factor 2A
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.TU.contig_30689.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2385900.0AC238590.1 Carica papaya BAC clone 12I03, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021911125.11e-149agamous-like MADS-box protein AGL62
TrEMBLA0A067EEZ47e-92A0A067EEZ4_CITSI; Uncharacterized protein
STRINGevm.TU.contig_30689.11e-179(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.18e-59AGAMOUS-like 62