PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.TU.contig_30005.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 165aa    MW: 18234.8 Da    PI: 5.6943
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.TU.contig_30005.2genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF51.99.4e-172265447
                           -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
                 SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                           en+   qvtfsk r  ++KKA+EL++LC  +v +i+fs++++ +
  evm.TU.contig_30005.2 22 ENEASLQVTFSKHRSSLFKKASELCTLCRPDVGLIVFSPRNRAF 65
                           899999*********************************99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006620.1421171IPR002100Transcription factor, MADS-box
SMARTSM004328.3E-211170IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.26E-201284IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-151333IPR002100Transcription factor, MADS-box
PfamPF003194.0E-192067IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-153348IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-154869IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MADEGTSSKS KGHQKIELIK MENEASLQVT FSKHRSSLFK KASELCTLCR PDVGLIVFSP  60
RNRAFCYGNP NIDIVIDHFL SIDVRPAKIL TMTMILNKQS VGSMRYDSNL DSVFDSFTLE  120
MLFADPLDDE NFIVDNPNEA ANSDNPKKMS PPLARNVLGS GQGF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.TU.contig_30005.2
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2385901e-143AC238590.1 Carica papaya BAC clone 12I03, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021909173.14e-64myocyte-specific enhancer factor 2-like
STRINGevm.TU.contig_30005.21e-118(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-29AGAMOUS-like 62