PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.TU.contig_28237.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family Dof
Protein Properties Length: 331aa    MW: 35928.2 Da    PI: 8.8944
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.TU.contig_28237.1genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.31.9e-3945105262
                 zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                            +++alkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+++
  evm.TU.contig_28237.1  45 EQAALKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRVK 105
                            67899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2943103IPR003851Zinc finger, Dof-type
PfamPF027019.5E-3447103IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.52549103IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105187IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MLGKCEKMPV ISSTTNQWSQ GHNQIDEKSL MASTARLMEK PCQQEQAALK CPRCDSSNTK  60
FCYYNNYSLS QPRHFCKACK RYWTRGGTLR NVPVGGGCRK NKRVKRSPAM DAPSSNPNKP  120
NHSQMNNNNN SSASSNPINP LFYGLPTNPS DPINLPFPRS VSTTSGYGLQ SQLNALGLGT  180
MNIMSHDAAV SDHNPLIINT TKQLQDMAVT SSSFLSTYPI FANSSPSSTP TISSLLASTL  240
HQQQKLINGT QPPNHFQSLA SLQDLQMGGG NSTELTGVVK GENGQEQSKM EWNQIDQVGL  300
SDPNSLYWNT TGLSAWHDPA NIGSSVTSLI *
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.TU.contig_28237.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021911851.10.0dof zinc finger protein DOF1.4-like
TrEMBLA0A061GGE91e-119A0A061GGE9_THECC; F-box family protein, putative
STRINGevm.TU.contig_28237.10.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47092650
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.11e-42Dof family protein