PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.TU.contig_24967.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family bZIP
Protein Properties Length: 354aa    MW: 40231.6 Da    PI: 5.3801
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.TU.contig_24967.6genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.24.2e-09136188456
                            XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                             k+ rr  +NR AA rsR+RKk+++  Le k+k Le+e ++L   l+    e 
  evm.TU.contig_24967.6 136 AKKRRRQLRNRNAALRSRERKKMYVRDLEMKSKYLEGECRRLGRLLQCFDAEN 188
                            6999**********************************998876666555555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-4133197IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.025135192IPR004827Basic-leucine zipper domain
PfamPF001701.5E-7136192IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.7E-11136194No hitNo description
SuperFamilySSF579593.56E-10137194No hitNo description
CDDcd147041.67E-15138189No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0030968Biological Processendoplasmic reticulum unfolded protein response
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MEDHGFPGDD VVEKIELDPL FVDCSDWFNL EPPVLSDSSP VEAFSNPSPE SVSSKICEIK  60
SLLMNEDYSN DELPQEENQQ FCCDFLADIL VKSPVQCSGS VEDLVDAPID KETNIHDEFD  120
GGDINEDGYD ANDPIAKKRR RQLRNRNAAL RSRERKKMYV RDLEMKSKYL EGECRRLGRL  180
LQCFDAENQA LRLSLHNGGS AFGTSWAKQE SAVLLLESLL LGSLVWFLGI ICLFCLPNLP  240
QSVLEAIPQE IMEKKDPESM APRGRGSKIF TSSVEESFAK SRRCKASRRR MKSFAFSVCP  300
TCLSQFWRPF HRKSWKRKIQ KAWLQEDEGI KYSHPQWKNL LQRAGDARPL GEG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1137156KRRRQLRNRNAALRSRERKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00019PBMTransfer from AT1G42990Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.TU.contig_24967.6
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021909218.11e-164bZIP transcription factor 60-like
TrEMBLA0A2I4FMW68e-79A0A2I4FMW6_JUGRE; bZIP transcription factor 60-like
STRINGevm.TU.contig_24967.60.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46342848
Representative plantOGRP54681518
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.13e-14basic region/leucine zipper motif 60