PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID IGS.gm_9_00367
Common NameCHLNCDRAFT_145560
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Chlorella
Family G2-like
Protein Properties Length: 530aa    MW: 54687.8 Da    PI: 6.5489
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
IGS.gm_9_00367genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like86.62.4e-271669255
         G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    +rlrW+p LH++Fv +v+qLGG+ +AtPk+i  +m+v+gLtl hvkSHLQkYR 
  IGS.gm_9_00367 16 TRLRWSPALHAQFVAVVQQLGGAFQATPKRIQLAMNVPGLTLFHVKSHLQKYRE 69
                    7****************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.33E-131370IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.6E-251369IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-201669IPR006447Myb domain, plants
PfamPF002499.1E-61768IPR001005SANT/Myb domain
PfamPF143791.3E-9276316IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 530 aa     Download sequence    Send to blast
MQHKQQQEGS SPQKRTRLRW SPALHAQFVA VVQQLGGAFQ ATPKRIQLAM NVPGLTLFHV  60
KSHLQKYREV TQGGRPAGNA SKKRSGGGDA GEAAAVRSEQ AAAPEHEHEH EHEQQQQQRD  120
LSAWDLCGAE DDGQCSPSDP FGDALLPPGW GTQPAPVVDA ELAASLAPAG SLNNQQAAGT  180
ELTQQPPAAA EPRCAVCERA AQHQQLPRAL PHHAAPQPAT AKPDRSASQL AAPQRSEASG  240
SQVAASEGAD PAAAAAAGVA PAASAPATSR LSILESALRV QMEMQRQLCC SMEAQRGLQM  300
QLEAHGQYIA GLLRCQARPP GHPTAAAGQA TGSAKAGSRA SSKLQLGVAG GGGGPPRGPP  360
PAGLHASLQQ HVFQRAELQP QPAQQQQALQ AQQAQLAQHP CGACTLLLRS DPPARSAAAP  420
AALEPAAPLS SGQPRPEPSC AGSRCSCDTS VVVACQQGGS WDAPRRQQQQ VGSEPPAGGE  480
DAFHEAAALP NAGSLDDSLY PADVWDSLLI DSGVLSRLLE GDSDGGLLC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-141568154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-141568154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-141568154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-141568154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_005848171.10.0hypothetical protein CHLNCDRAFT_145560
TrEMBLE1ZDR50.0E1ZDR5_CHLVA; Uncharacterized protein
STRINGXP_005848171.10.0(Chlorella variabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1111645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.11e-17G2-like family protein
Publications ? help Back to Top
  1. Blanc G, et al.
    The Chlorella variabilis NC64A genome reveals adaptation to photosymbiosis, coevolution with viruses, and cryptic sex.
    Plant Cell, 2010. 22(9): p. 2943-55
    [PMID:20852019]