PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID IGS.gm_5_00463
Common NameCHLNCDRAFT_143134
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Chlorella
Family G2-like
Protein Properties Length: 514aa    MW: 52145.6 Da    PI: 7.1218
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
IGS.gm_5_00463genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like82.45e-26114168155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k+rlrW+p+LH+rF +av++LGGs +A Pk i+  m+v+gLtl+hvkSHLQk+R 
  IGS.gm_5_00463 114 KERLRWSPQLHQRFCKAVAELGGSAVAKPKDIVTKMGVPGLTLAHVKSHLQKHRQ 168
                     68***************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.569111171IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-24112168IPR009057Homeodomain-like
SuperFamilySSF466892.15E-12113168IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-19114169IPR006447Myb domain, plants
PfamPF002491.3E-7116167IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 514 aa     Download sequence    Send to blast
MHMVAAGCGK AVAAKLTAAD TPAGSGEGGK ASSASTDDVE LGVVERSEQP TIKLEVAAAE  60
QQHLPAAADA LSDYFNAAAA ALPSSLPPAA PTTSSPLATD SEDGEALRVT IDSKERLRWS  120
PQLHQRFCKA VAELGGSAVA KPKDIVTKMG VPGLTLAHVK SHLQKHRQQE GVTYVPHSTR  180
NSPAATRRFH SQQHAAAAQP RGWPAAGRSG SSSDSEEPPA AKRARTASRG ASPASGDASA  240
GGQWAQQPRQ PLGAVVGGDG GAAGMPMASS AAATASSADP FLHYLQALAS VPAAQPQEAP  300
PPLPVPLESA AEQDDGGLHR LHALAELAST QYDELMAERR ALEGQAATLG ALAERLAAPP  360
HQAQWAAQAP GLHATVGPLL LRQAQVQEAV REHMRRGALL MEEVRAFQRA AQEQLAQQVQ  420
QGPGAMSMVA AAMAALRGAA EQRGGPAVGQ PGVPPSLATQ LLAVMAAAGV GAAPGVVPPA  480
PQPAPNAAGA AAGLAQLQHL YQSAAMLAAR QQA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_005849631.10.0hypothetical protein CHLNCDRAFT_143134
TrEMBLE1Z9J40.0E1Z9J4_CHLVA; Uncharacterized protein
STRINGXP_005849631.10.0(Chlorella variabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1111645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.12e-18G2-like family protein
Publications ? help Back to Top
  1. Blanc G, et al.
    The Chlorella variabilis NC64A genome reveals adaptation to photosymbiosis, coevolution with viruses, and cryptic sex.
    Plant Cell, 2010. 22(9): p. 2943-55
    [PMID:20852019]