PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID IGS.gm_4_00340
Common NameCHLNCDRAFT_142199
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Chlorella
Family G2-like
Protein Properties Length: 1292aa    MW: 136503 Da    PI: 6.8121
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
IGS.gm_4_00340genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like23.89.8e-08631664437
         G2-like   4 lrWtpeLHerFveaveqLGGsekAtPktilelmk 37 
                     +rWt +L e+F eav+ +GG + A Pk+i ++++
  IGS.gm_4_00340 631 VRWTGKLKEAFTEAVDLMGGVHSARPKAIWDALH 664
                     69***************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
HamapMF_0045632.69920273IPR005715Glutamate 5-kinase/delta-1-pyrroline-5-carboxylate synthase
PfamPF006961.2E-3821249IPR001048Aspartate/glutamate/uridylate kinase
CDDcd042421.13E-12121269No hitNo description
TIGRFAMsTIGR010276.5E-12022371IPR005715Glutamate 5-kinase/delta-1-pyrroline-5-carboxylate synthase
SuperFamilySSF536336.68E-6022269IPR001048Aspartate/glutamate/uridylate kinase
Gene3DG3DSA:3.40.1160.101.0E-5422269IPR001048Aspartate/glutamate/uridylate kinase
PRINTSPR004741.1E-485872IPR001057Glutamate/acetylglutamate kinase
PRINTSPR004741.1E-4892120IPR001057Glutamate/acetylglutamate kinase
PRINTSPR004741.1E-48132153IPR001057Glutamate/acetylglutamate kinase
PRINTSPR004741.1E-48164191IPR001057Glutamate/acetylglutamate kinase
PROSITE patternPS009020222239IPR019797Glutamate 5-kinase, conserved site
PRINTSPR004741.1E-48224244IPR001057Glutamate/acetylglutamate kinase
Gene3DG3DSA:2.30.130.101.1E-19280369IPR015947PUA-like domain
PROSITE profilePS5089013.54281359IPR002478PUA domain
PfamPF014722.9E-14282353IPR002478PUA domain
SMARTSM003591.9E-12282365IPR002478PUA domain
SuperFamilySSF886974.16E-16282372IPR015947PUA-like domain
Gene3DG3DSA:1.10.10.603.1E-5631673IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006561Biological Processproline biosynthetic process
GO:0016310Biological Processphosphorylation
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003723Molecular FunctionRNA binding
GO:0004349Molecular Functionglutamate 5-kinase activity
Sequence ? help Back to Top
Protein Sequence    Length: 1292 aa     Download sequence    Send to blast
MRSPAVTRST SQFFNPTAHP CVVIKVGTSS LIRAEQGSLN LSSLASIVET ARDLKAHGFN  60
VIIVSSGAVG VGCQRLRLCV RPDSLAQKQA LAAVGQVHLM RYYDDLFTAV DMKCAQVLLT  120
LDNLANRSQY INAKNTFEEL LRLGVVPIVN ENDTVAVQEL RIGDNDTLSA QVATLVQAEW  180
LFLLTDVPNL FTANPSTDPE AQPIYEVPDL SKLHVDTTTR GTQWGTGGMA TKLTAARIAT  240
AAGCRMVICT AEEPRNIPRI IAGERIGTVG RKRWILSVPV RGEVWLDEGA QRAVQERKKS  300
LFSAGILEVK GEFEAQDAVS LCDCHGEEFA RALINYAQDE VDKVKGLNSR EFASGLGYMG  360
QEEVCHRANI CLLLTHHDDS DHEQDSGHSP YDGPSRSTTP PIGSILPAAV AAADAAVAAG  420
TRSPPGSGGG HHTPGSHNSA RPHLPPRRPP HSSSSGSIAS TSNSFRQQYE QLEQQRQHQL  480
EQELAAQQAE SQELAARLAV LQSRGGGTPV TAQGVIGRAS GTTSTNWDAE LAAAIAHERQ  540
QEQLAEPVRL LTHLVRALLR VRSPPLEAAF EAEVKRLGGV QSARPKQLLD ALRPQFPELN  600
LQLQSCKWHL QTLRKREQRE LEWLATNSGP VRWTGKLKEA FTEAVDLMGG VHSARPKAIW  660
DALHHTYPML TVQTLRKKQG QGGEGEEDET MLEGDRSQGD TPSVGGTSSD QQQGPERGPL  720
SAKRQYSADS GGNPQQQQPP PQQQAQEQQQ EPPQQPLVTA LQPQRGVPPL PPPPPLPPPP  780
QRHERQLGVG TGSTSRGQVR EPQEQEGEQQ GWQQQVQQQR QLRRQQLQHA LVQPPGSASW  840
GIDLAAAAQQ ARRRATAISR HVRVLIAELE LHAAGQAEAV HLLQQEQASG REVTEATLLA  900
LADQLQGAQP GGSGPSSAAA ATAAAVLAAA RALGALTPAP DGSAGAGEAG ADGGGLGHTR  960
RRRDTAVLGS LVPLVREGAL AAAPPADPGH NPATCRVPGC RRCAYLDRRA GQEAERAGQQ  1020
AAAAPDSLPQ HVQAPPAPAS TSAPAAAVSQ WVLQQQRLAG LPDWLQQPGA AAAPGVRLAT  1080
TPGGSGSGSG GSLPGSVAAA LAAFQPLPDA AQPLSISDNT SSMSSLESLL NAAEKMEMAA  1140
SMSRREQSAL LDLLHSDPTL LSSAAAMLLA LPTLTLAPPP ATSPTPAMAA PSTQASPVST  1200
HQPGAAHPAL DATLWGAICR AVPASNAAGQ RAMAAWLVEA GATTPRDVVS LLDSSPLVLQ  1260
LAHEAAKAEG VRLMEWAALL NTCKQLGAAP R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2j5t_A4e-63223717365GLUTAMATE 5-KINASE
2j5t_B4e-63223717365GLUTAMATE 5-KINASE
2j5t_C4e-63223717365GLUTAMATE 5-KINASE
2j5t_D4e-63223717365GLUTAMATE 5-KINASE
2j5t_E4e-63223717365GLUTAMATE 5-KINASE
2j5t_F4e-63223717365GLUTAMATE 5-KINASE
2j5t_G4e-63223717365GLUTAMATE 5-KINASE
2j5t_H4e-63223717365GLUTAMATE 5-KINASE
2j5v_A4e-63223717365GLUTAMATE 5-KINASE
2j5v_B4e-63223717365GLUTAMATE 5-KINASE
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_005850359.10.0hypothetical protein CHLNCDRAFT_142199
TrEMBLE1Z8030.0E1Z803_CHLVA; Uncharacterized protein
STRINGXP_005850359.10.0(Chlorella variabilis)
Publications ? help Back to Top
  1. Blanc G, et al.
    The Chlorella variabilis NC64A genome reveals adaptation to photosymbiosis, coevolution with viruses, and cryptic sex.
    Plant Cell, 2010. 22(9): p. 2943-55
    [PMID:20852019]