PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID IGS.gm_4_00058
Common NameCHLNCDRAFT_141917
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Chlorella
Family G2-like
Protein Properties Length: 626aa    MW: 63332.2 Da    PI: 6.4041
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
IGS.gm_4_00058genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.45.7e-32245299155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k rlrWtp+LH rFv av++LGG+++AtPk il+lm+v+gLt++h+kSHLQkYRl
  IGS.gm_4_00058 245 KSRLRWTPDLHGRFVGAVNELGGPDRATPKGILKLMGVEGLTIYHIKSHLQKYRL 299
                     68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.926242302IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.7E-31242301IPR009057Homeodomain-like
SuperFamilySSF466894.48E-17243302IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-24245299IPR006447Myb domain, plants
PfamPF002491.0E-7247298IPR001005SANT/Myb domain
PfamPF143796.5E-14379421IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 626 aa     Download sequence    Send to blast
MGDTPKRSEP LENEAHSPLS LEFWPDAAPL NLDAMNNSLD WLGDLGHDQG GQGGAPPALP  60
PGDPLGGGAA DTLPHGGGGS SSQLQHQQLL HSQLQSLHPM LAMGPAPGGD PLICGGSNGA  120
SGGDIYGGSG DLSGTLHLHL HPPMQPGGLP GGGDPALAHL PPLGPTGVAA PGGPLHAAGL  180
AFAHDLVGGH HQHLYQQPPM MHHQQQAFLS PYPGERSRPA GRAPTRPRRP AAARGVTLSA  240
AQSQKSRLRW TPDLHGRFVG AVNELGGPDR ATPKGILKLM GVEGLTIYHI KSHLQKYRLN  300
IKLPGDQQEA TEGERARRGR RRASRSKSES PADEDEEEEG EEEEGGSRRE SREQAPADSG  360
GGGGGAVSGG SGGSSRRQQL EDALLLQMEM QKKLHEQLEA QRQLQLSLEA HSRYITSLLE  420
QSDLRGSLPA HLVTGSSSGA QAALQQLQRE GGAAAAPAAA PAALASAGSG APVAAFSAAA  480
AAQAPSPALP RSEQQQQQQQ QQQGGAAARL GKGGGDATAA PTAGTAGTGS LTAFGATATT  540
LASVSPLAPR GGVQPPSPGS ALLDFEMAEA AAAWDAAAAG VGGPLPKLQL DPSAAAAAAA  600
QEAAPAVLAP AGEPGGAEPK RQRTT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A7e-22245298154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-22245298154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-22245298154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-22245298154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
127DTPKRS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00252DAPTransfer from AT2G01060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_005850246.10.0hypothetical protein CHLNCDRAFT_141917
TrEMBLE1Z7B80.0E1Z7B8_CHLVA; Uncharacterized protein
STRINGXP_005850246.10.0(Chlorella variabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1111645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.12e-25G2-like family protein
Publications ? help Back to Top
  1. Blanc G, et al.
    The Chlorella variabilis NC64A genome reveals adaptation to photosymbiosis, coevolution with viruses, and cryptic sex.
    Plant Cell, 2010. 22(9): p. 2943-55
    [PMID:20852019]