PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID IGS.gm_16_00059
Common NameCHLNCDRAFT_136336
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Chlorella
Family G2-like
Protein Properties Length: 576aa    MW: 58370.4 Da    PI: 7.1177
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
IGS.gm_16_00059genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like841.6e-26467521155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k+rl Wtp LH+rF+eav++ GG +kA Pk++++ m+v gLt+e+v+SHLQk+R+
  IGS.gm_16_00059 467 KARLIWTPALHRRFLEAVNRVGGVDKALPKAVMKEMGVSGLTRENVASHLQKHRM 521
                      68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.334464524IPR017930Myb domain
SuperFamilySSF466898.06E-17465525IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.4E-26466525IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-21467522IPR006447Myb domain, plants
PfamPF002492.9E-6472520IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 576 aa     Download sequence    Send to blast
MALWGGGGAD FWSSEQAGLS NPGQQDLDSF LQGLLSETVD LNAPLVPGPL AVSFGLSTDS  60
SVSCLPPRAA VALGGRGAQG VGVAAPSHAR RRSGQQQAAA GGSGAATASK DQLVPALPGG  120
PMASAGNGQQ ARQPLASPAA QQQQRAAAAA RAAHSLRLDA SGQQEQSGQP PASFSGLLTE  180
QAAAAAAALA EAPQAAAGAA ATEGGTADGG DGPSQPFGSA DREQQAAAPP HLRYDFAQAQ  240
QDQAAVVAQF QQAQQAQQAQ QAAAAALFAQ QQAAYQQASY QQQQQAAYQQ QQAAQAAQAA  300
AGQGQGGGDP NSAAAFFQRQ QQQAAAAAAA AFQFQNPYGA WGMYGPQYGQ QYGQQYPNYY  360
PPYGTNMQFQ GMQFPGMQQQ GGGQMGGGQM GGTSGMGFPP MTGASGAGAG NPAAPPGVLP  420
PAGPQLQQQL PGMTEVVQQS EGAAHGGAAA ATVGLGGFDD DPCALKKARL IWTPALHRRF  480
LEAVNRVGGV DKALPKAVMK EMGVSGLTRE NVASHLQKHR MRLKKEEEEG GGGVHTGHHT  540
PAGSGRGVAR VKHVDEDDIA SMRQPGGRLP RAACR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A2e-16467524157Transcription factor LUX
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_005845848.10.0hypothetical protein CHLNCDRAFT_136336
TrEMBLE1ZK560.0E1ZK56_CHLVA; Uncharacterized protein
STRINGXP_005845848.10.0(Chlorella variabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1111645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05090.17e-19G2-like family protein
Publications ? help Back to Top
  1. Blanc G, et al.
    The Chlorella variabilis NC64A genome reveals adaptation to photosymbiosis, coevolution with viruses, and cryptic sex.
    Plant Cell, 2010. 22(9): p. 2943-55
    [PMID:20852019]