PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID IGS.gm_15_00154
Common NameCHLNCDRAFT_136058
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Chlorella
Family G2-like
Protein Properties Length: 127aa    MW: 13590.7 Da    PI: 11.5628
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
IGS.gm_15_00154genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like59.76.3e-19152455
          G2-like  4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     +rWt+    rF +aveq GG+  AtP++il+++ ++g+t ++vkSHLQ+YR+
  IGS.gm_15_00154  1 MRWTKAAQMRFQQAVEQSGGIMAATPRAILDALTMEGVTYAQVKSHLQRYRT 52
                     79*************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-17153IPR009057Homeodomain-like
SuperFamilySSF466895.38E-9152IPR009057Homeodomain-like
TIGRFAMsTIGR015579.5E-16152IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
MRWTKAAQMR FQQAVEQSGG IMAATPRAIL DALTMEGVTY AQVKSHLQRY RTAHIAELLE  60
RGEEVGDASE AQLSVAARRG RPELPPPAAA AAAEAARSRA AAPAGRRALK LQRALRCRKA  120
HLPVAL*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_005846122.14e-83hypothetical protein CHLNCDRAFT_136058
TrEMBLE1ZJN48e-82E1ZJN4_CHLVA; Uncharacterized protein
STRINGXP_005846122.11e-82(Chlorella variabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1111645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.33e-12G2-like family protein
Publications ? help Back to Top
  1. Blanc G, et al.
    The Chlorella variabilis NC64A genome reveals adaptation to photosymbiosis, coevolution with viruses, and cryptic sex.
    Plant Cell, 2010. 22(9): p. 2943-55
    [PMID:20852019]