PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold20977-augustus-gene-0.2-mRNA-2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family bZIP
Protein Properties Length: 349aa    MW: 38617.8 Da    PI: 6.5618
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold20977-augustus-gene-0.2-mRNA-2genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.11e-09146194553
                                                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                                        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                                                   kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l   +
  maker-scaffold20977-augustus-gene-0.2-mRNA-2 146 KRAKRILANRQSAARSKERKARYILELERKVQTLQTEATTLSAQLTLFQ 194
                                                   9****************************************99887655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.1E-16142206IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.542144207IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.4E-9146200No hitNo description
PfamPF001701.7E-8146194IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.1E-10146197No hitNo description
CDDcd147039.36E-24147196No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MDHPTPKNPV SQTQQQQPQS DSDMGLSNPS RTGHHRRAHS EVHFRIPDDL DLGFDGGPSS  60
AAGFDEDDLF CTYMDIEKLG SRPDGHGSVA KPDNAGEEGE AEQSLRTRHR HSNSVDGGSL  120
NLMDSIEAKK AMAPAKLAEL WTVDPKRAKR ILANRQSAAR SKERKARYIL ELERKVQTLQ  180
TEATTLSAQL TLFQRDTTGL STENTELKLR LQAMEQQAQL RDALNEALKK EVERLKIATG  240
EIMTHNDTTY NLGMHHVSYP SSSFFSHQPQ PQPGDPQNIQ MPSPFHQFQS NTSTAHQPLL  300
AAAHSHAFTD MLQQDPLGRL QGLDISGRGS HMVKPEGTSI SVSESSNTF
Functional Description ? help Back to Top
Source Description
UniProtTranscrition factor that may participate with bZIP34 in the gametophytic control of pollen development. {ECO:0000269|PubMed:27896439}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023907746.10.0transcription factor RF2b
SwissprotO228731e-113BZP18_ARATH; bZIP transcription factor 18
TrEMBLA0A2I4ER271e-168A0A2I4ER27_JUGRE; transcription factor RF2b
STRINGVIT_13s0067g02900.t011e-161(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.11e-110bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Pawar V, et al.
    A novel family of plant nuclear envelope-associated proteins.
    J. Exp. Bot., 2016. 67(19): p. 5699-5710
    [PMID:27630107]
  3. Gibalová A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  5. Babiychuk E,Fuangthong M,Van Montagu M,Inzé D,Kushnir S
    Efficient gene tagging in Arabidopsis thaliana using a gene trap approach.
    Proc. Natl. Acad. Sci. U.S.A., 1997. 94(23): p. 12722-7
    [PMID:9356517]