PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold20977-augustus-gene-0.2-mRNA-1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family bZIP
Protein Properties Length: 366aa    MW: 40505.2 Da    PI: 6.8042
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold20977-augustus-gene-0.2-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                                                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                                        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                                                   kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l   +
  maker-scaffold20977-augustus-gene-0.2-mRNA-1 146 KRAKRILANRQSAARSKERKARYILELERKVQTLQTEATTLSAQLTLFQ 194
                                                   9****************************************99887655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.1E-16142206IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.542144207IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.34E-10146197No hitNo description
PfamPF001701.9E-8146194IPR004827Basic-leucine zipper domain
Gene3DG3DSA: hitNo description
CDDcd147034.24E-24147196No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
Functional Description ? help Back to Top
Source Description
UniProtTranscrition factor that may participate with bZIP34 in the gametophytic control of pollen development. {ECO:0000269|PubMed:27896439}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023907746.10.0transcription factor RF2b
SwissprotO228731e-110BZP18_ARATH; bZIP transcription factor 18
TrEMBLA0A2I4ER271e-163A0A2I4ER27_JUGRE; transcription factor RF2b
STRINGVIT_13s0067g02900.t011e-160(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.11e-107bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
  2. Pawar V, et al.
    A novel family of plant nuclear envelope-associated proteins.
    J. Exp. Bot., 2016. 67(19): p. 5699-5710
  3. Gibalová A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
  5. Babiychuk E,Fuangthong M,Van Montagu M,Inzé D,Kushnir S
    Efficient gene tagging in Arabidopsis thaliana using a gene trap approach.
    Proc. Natl. Acad. Sci. U.S.A., 1997. 94(23): p. 12722-7