PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold18635-augustus-gene-0.2-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family LBD
Protein Properties Length: 169aa    MW: 19208.6 Da    PI: 6.3381
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold18635-augustus-gene-0.2-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260118.93e-3761051100
                                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeA 65 
                                                   +CaaCk lrr+C++dCvlapyfp ++p+ f +vhk+FGasn++k+l++l+ + r  a++++ +eA
  maker-scaffold18635-augustus-gene-0.2-mRNA-1   6 RCAACKSLRRRCPTDCVLAPYFPPTNPQGFSCVHKIFGASNITKMLEQLSVHLRAVAADCMSFEA 70 
                                                   6**************************************************************** PP

                                        DUF260  66 earardPvyGavgvilklqqqleqlkaelallkee 100
                                                     r++dPvyG+v++i++lq+q+ +++ el+++k e
  maker-scaffold18635-augustus-gene-0.2-mRNA-1  71 SSRVEDPVYGSVRIISQLQEQITEAQRELVKTKGE 105
                                                   *****************************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.5275106IPR004883Lateral organ boundaries, LOB
PfamPF031952.1E-366102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MSNSSRCAAC KSLRRRCPTD CVLAPYFPPT NPQGFSCVHK IFGASNITKM LEQLSVHLRA  60
VAADCMSFEA SSRVEDPVYG SVRIISQLQE QITEAQRELV KTKGEIAFHN AQQQQQQQMQ  120
QLQMIHAIAQ EGEDQHSWLS SSQQDPFPNV NQQLIEDYKY SNTFFGFEF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-324999104LOB family transfactor Ramosa2.1
5ly0_B6e-324999104LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023929826.11e-101LOB domain-containing protein 24-like
SwissprotP594681e-42LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A1U8B9X85e-60A0A1U8B9X8_NELNU; LOB domain-containing protein 24-like
STRINGXP_010278070.19e-61(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.12e-44LOB domain-containing protein 24