PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold17244-snap-gene-0.11-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family WRKY
Protein Properties Length: 336aa    MW: 38082.1 Da    PI: 8.1395
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold17244-snap-gene-0.11-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY811.2e-252884259
                                               --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                                       WRKY  2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                                               dDgy+WrKY qK vkg+e+prsYY+Ct  gC+++k ve+s    ++ +++Yeg+Hnhe
  maker-scaffold17244-snap-gene-0.11-mRNA-1 28 DDGYRWRKYEQKLVKGNEYPRSYYKCTCVGCNARKWVEQSP-AREISKMKYEGKHNHE 84
                                               8****************************************.99*************8 PP

2WRKY78.86e-25162218260
                                                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                                       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                                                +Dg++WrKYGqK+ + s +prsYY+Ct+++Cp+kk ve s+  ++++ei+Y+g+Hnh+k
  maker-scaffold17244-snap-gene-0.11-mRNA-1 162 NDGFKWRKYGQKN-NFSVYPRSYYKCTYSSCPAKKMVESSH-AGHITEIVYKGTHNHPK 218
                                                8***********9.6799*********************99.9**************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.9042286IPR003657WRKY domain
SuperFamilySSF1182904.05E-212386IPR003657WRKY domain
Gene3DG3DSA:2.20.25.809.7E-232586IPR003657WRKY domain
SMARTSM007743.5E-252785IPR003657WRKY domain
PfamPF031067.9E-202884IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.9E-22155219IPR003657WRKY domain
PROSITE profilePS5081117.155156219IPR003657WRKY domain
SuperFamilySSF1182904.05E-20159219IPR003657WRKY domain
SMARTSM007741.1E-23161218IPR003657WRKY domain
PfamPF031062.0E-20162217IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MESSKASHSD KKYQNSEPTV VANTFNSDDG YRWRKYEQKL VKGNEYPRSY YKCTCVGCNA  60
RKWVEQSPAR EISKMKYEGK HNHEMPNKLA KEISDLQCLA RNMNIQSQLE TAYSVLEKDQ  120
ESTAFTLTES DCEEESVAET REEVSHFDRT YQPTIAVDKP TNDGFKWRKY GQKNNFSVYP  180
RSYYKCTYSS CPAKKMVESS HAGHITEIVY KGTHNHPKPQ PSIKCAKEGS NLSGNINSQA  240
KPDLGLQNQA GNRNKSSQVV PAYTVPERDQ ESTQTALTQL TGSRDNEGEG DAETIEEGAG  300
PNPKRRHVER CWVIWGPFVT QDSGRTKNHG GQRQSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-1928861877Probable WRKY transcription factor 4
2lex_A2e-1928861877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010661104.13e-50PREDICTED: probable WRKY transcription factor 4
TrEMBLF6H5W33e-50F6H5W3_VITVI; Putative uncharacterized protein
STRINGVIT_14s0108g01280.t011e-49(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.13e-32WRKY DNA-binding protein 3