PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold16464-augustus-gene-0.2-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 347aa    MW: 38251.9 Da    PI: 9.1643
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold16464-augustus-gene-0.2-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.37.5e-54151421128
                                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrd 65 
                                                   lppGfrFhPtdeelvv+yLk+k+++ +l++ ++i+e+d+yk++Pw+Lp+k++ +e+ewyfFs+rd
  maker-scaffold16464-augustus-gene-0.2-mRNA-1  15 LPPGFRFHPTDEELVVHYLKRKLASAPLPV-TIIAEIDLYKFDPWELPSKATFGEQEWYFFSPRD 78 
                                                   79****************************.89***************8888999********** PP

                                           NAM  66 kkyatgkrknratksgyWkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                                   +ky++g r+nra++sgyWkatg+dk++l++ ++++vg+kk Lvfy g+ pkg kt+W+mheyrl
  maker-scaffold16464-augustus-gene-0.2-mRNA-1  79 RKYPNGARPNRAATSGYWKATGTDKPILTSnGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRL 142
                                                   ***************************99867788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-6410178IPR003441NAC domain
PROSITE profilePS5100562.21315178IPR003441NAC domain
PfamPF023652.4E-2816142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MESTDSSSGS QHPQLPPGFR FHPTDEELVV HYLKRKLASA PLPVTIIAEI DLYKFDPWEL  60
PSKATFGEQE WYFFSPRDRK YPNGARPNRA ATSGYWKATG TDKPILTSNG TQKVGVKKAL  120
VFYGGKPPKG IKTNWIMHEY RLVDNTSTSK PTTTASDATN KKGSLRLDDW VLCRIYKKNN  180
TQRPIMDQDK EDSMEAMIPT MPTMSMASQH NGKVPLPSKT ANYTALLDND FENYFDGILS  240
AEGMQNGSIS HNLATSSSKS STLAVKRTLP SQFWNEAGSL GSSSSGGKRF HGDLNSGSAG  300
LDENNSFVSL LNQLPQGASF HSNSLLGSLC DGVLRQQFQL PSINWNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-751518117168NO APICAL MERISTEM PROTEIN
1ut4_B1e-751518117168NO APICAL MERISTEM PROTEIN
1ut7_A1e-751518117168NO APICAL MERISTEM PROTEIN
1ut7_B1e-751518117168NO APICAL MERISTEM PROTEIN
4dul_A1e-751518117168NAC domain-containing protein 19
4dul_B1e-751518117168NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family. May be associated with anther development and pollen production (Probable). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305|PubMed:21107887}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBMTransfer from AT1G61110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023921724.10.0NAC transcription factor 25-like
SwissprotQ8GY421e-118NAC25_ARATH; NAC transcription factor 25
TrEMBLA0A2I4DIM40.0A0A2I4DIM4_JUGRE; NAC transcription factor 25
STRINGEOY283341e-178(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.11e-119NAC domain containing protein 25