PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold14907-augustus-gene-0.3-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 607aa    MW: 69774 Da    PI: 5.5413
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold14907-augustus-gene-0.3-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1341e-41581841128
                                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskr 64 
                                                   lppG+rF Ptd el+ +yL+kkv++++l+  + i e+++y ++P+ L  +  k +e+e+yfF++r
  maker-scaffold14907-augustus-gene-0.3-mRNA-1  58 LPPGYRFCPTDVELIRFYLNKKVSNEPLPP-NQIVETNLYGYNPEFLAaNYRKCGENECYFFTPR 121
                                                   79*************************999.77**************9445556899******** PP

                                           NAM  65 dkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                                   d+ky +g r+nra+ +gyWkatg dk+++  +++l+g kk Lvf +g+ p+g+kt+W+mhe+r+
  maker-scaffold14907-augustus-gene-0.3-mRNA-1 122 DRKYLNGVRPNRAAGDGYWKATGVDKPIIF-NETLIGYKKALVFCQGKPPNGTKTNWIMHEFRV 184
                                                   ******************************.999****************************97 PP

2NAM138.34.9e-432503752128
                                           NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka.eekewyfFskrd 65 
                                                   ppG+rF Ptd+elv +yL+kkv++++l+  + i e+++y ++P+ L +++++ +e e+yfF++rd
  maker-scaffold14907-augustus-gene-0.3-mRNA-1 250 PPGYRFCPTDDELVRFYLNKKVSNEPLPP-NQIVETNLYLHNPEFLAANYNKcGEYECYFFTPRD 313
                                                   9*************************999.77**************9544442777********* PP

                                           NAM  66 kkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                                   +ky +g+r+nra+ +gyWkatg dk+++  ++ l+g +k Lvfy+g+ap+g+kt+W+mhe+r+
  maker-scaffold14907-augustus-gene-0.3-mRNA-1 314 RKYLNGNRPNRAAGDGYWKATGADKHIIF-DEVLIGYRKALVFYRGKAPNGTKTNWIMHEFRV 375
                                                   *****************************.99*****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-5255210IPR003441NAC domain
PROSITE profilePS5100548.76458210IPR003441NAC domain
PfamPF023655.6E-2259184IPR003441NAC domain
SuperFamilySSF1019414.58E-53244401IPR003441NAC domain
PROSITE profilePS5100549.736249401IPR003441NAC domain
PfamPF023659.7E-24250375IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 607 aa     Download sequence    Send to blast
PPAQTEALNI IEHCNNTNNI TPLTTPPVVS QDDYDSDVDD LLKEIEDFAS DEFSFDDLPP  60
GYRFCPTDVE LIRFYLNKKV SNEPLPPNQI VETNLYGYNP EFLAANYRKC GENECYFFTP  120
RDRKYLNGVR PNRAAGDGYW KATGVDKPII FNETLIGYKK ALVFCQGKPP NGTKTNWIMH  180
EFRVDNPPRE KRNPGDMRLD DSVLCRIYNK TDPKTKSNRK STWINIRKGM ELEEALLDLF  240
FDTFPFDTFP PGYRFCPTDD ELVRFYLNKK VSNEPLPPNQ IVETNLYLHN PEFLAANYNK  300
CGEYECYFFT PRDRKYLNGN RPNRAAGDGY WKATGADKHI IFDEVLIGYR KALVFYRGKA  360
PNGTKTNWIM HEFRVDTPPR DKRSPGDMKL DDSVLCRIYK KTEKKSTQAH TQDEEVPNST  420
SLPQNEPMEY FEFKDPMAQM IYDHDYMLQS DQNAPSALLE VPQNSNATTL IDMPGFHDPF  480
QARGGSIFET PVQSNQQSFC LPPSLNSAET LNLPSRYQHW SYATNPFKNT SAMQSDYYNY  540
CVYQQASLNN QVSTSMPSPG NDPNMLLILN NQVSTSTPSH QVSPSMPFSS NDPHKRQKLS  600
NDDHSFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-475840116171NO APICAL MERISTEM PROTEIN
1ut4_B1e-475840116171NO APICAL MERISTEM PROTEIN
1ut7_A1e-475840116171NO APICAL MERISTEM PROTEIN
1ut7_B1e-475840116171NO APICAL MERISTEM PROTEIN
3swm_A1e-475840119174NAC domain-containing protein 19
3swm_B1e-475840119174NAC domain-containing protein 19
3swm_C1e-475840119174NAC domain-containing protein 19
3swm_D1e-475840119174NAC domain-containing protein 19
3swp_A1e-475840119174NAC domain-containing protein 19
3swp_B1e-475840119174NAC domain-containing protein 19
3swp_C1e-475840119174NAC domain-containing protein 19
3swp_D1e-475840119174NAC domain-containing protein 19
4dul_A1e-475840116171NAC domain-containing protein 19
4dul_B1e-475840116171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family associated with the grain protein content (GPC). Accelerates senescence and increases nutrient remobilization from leaves to developing grains. Sequences of 11 European varieties of H.vulgare tested belongs to the same haplotype while the sequence found in H.spontaneum, an ancestor of the cultivated H.vulgare which has a higher GPC, belongs to an other haplotype. {ECO:0000269|PubMed:17124321, ECO:0000269|PubMed:20005003}.
UniProtTranscription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence and reduces fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. {ECO:0000269|PubMed:29760199}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. {ECO:0000269|PubMed:29760199}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017982374.11e-72PREDICTED: NAC domain-containing protein 67
SwissprotA0SPJ86e-50NAM1_HORVV; NAC transcription factor NAM-1
SwissprotK4BWV23e-50NAP1_SOLLC; NAC domain-containing protein 1
STRINGXP_008227355.17e-71(Prunus mume)
STRINGEMJ156851e-71(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101121642
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.17e-52NAC domain containing protein 32
Publications ? help Back to Top
  1. Uauy C,Distelfeld A,Fahima T,Blechl A,Dubcovsky J
    A NAC Gene regulating senescence improves grain protein, zinc, and iron content in wheat.
    Science, 2006. 314(5803): p. 1298-301
    [PMID:17124321]
  2. Jamar C, et al.
    NAM-1gene polymorphism and grain protein content in Hordeum.
    J. Plant Physiol., 2010. 167(6): p. 497-501
    [PMID:20005003]
  3. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  4. Ma X, et al.
    The NAC Transcription Factor SlNAP2 Regulates Leaf Senescence and Fruit Yield in Tomato.
    Plant Physiol., 2018. 177(3): p. 1286-1302
    [PMID:29760199]