PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold14381-snap-gene-0.10-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family HD-ZIP
Protein Properties Length: 699aa    MW: 75827.1 Da    PI: 6.2481
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold14381-snap-gene-0.10-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.63.2e-2147102156
                                                TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                                   Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                                +++ +++t++q++eLe+lF+++++p++++r eL+++l L++rqVk+WFqNrR+++k
  maker-scaffold14381-snap-gene-0.10-mRNA-1  47 KKRYHRHTPQQIQELEALFKECPHPDEKQRMELSRRLCLETRQVKFWFQNRRTQMK 102
                                                688999***********************************************999 PP

2START138.37.9e-442564341160
                                                HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHH CS
                                      START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvla 59 
                                                ela++a++elvk+a+ +ep+Wv+s     e++n +e++++f++  +     + +ea+r++g+v+ ++ 
  maker-scaffold14381-snap-gene-0.10-mRNA-1 256 ELALTAMDELVKLAQTDEPLWVRSLeggrEILNHEEYMRSFTPCIGlkqngFVTEASRETGMVIINSL 323
                                                5899*************************************99888999999**************** PP

                                                HHHHHHCCCGGCT-TT-S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEE CS
                                      START  60 llveellddkeqWdetla....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyir 116
                                                 lve+l+d++ +W e+++      +t++vissg      galqlm aelq+lsplvp R++ f+R+++
  maker-scaffold14381-snap-gene-0.10-mRNA-1 324 ALVETLMDSN-RWAEMFPcmiaITSTTDVISSGmggtrnGALQLMHAELQVLSPLVPvREVNFLRFCK 390
                                                **********.*******9998899******************************************* PP

                                                E.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTC CS
                                      START 117 qlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksng 160
                                                q+ +g+w++vdvSvds ++ +  + +v +++lpSg+++++++ng
  maker-scaffold14381-snap-gene-0.10-mRNA-1 391 QHAEGVWAVVDVSVDSIRETSGAPTFVNCRRLPSGCVVQDMPNG 434
                                                *******************999*********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.56E-2130104IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.4E-223398IPR009057Homeodomain-like
PROSITE profilePS5007117.28144104IPR001356Homeobox domain
SMARTSM003891.5E-1745108IPR001356Homeobox domain
CDDcd000869.19E-1946104No hitNo description
PfamPF000461.0E-1847102IPR001356Homeobox domain
PROSITE patternPS00027079102IPR017970Homeobox, conserved site
PROSITE profilePS5084831.342247440IPR002913START domain
SuperFamilySSF559611.54E-22249435No hitNo description
CDDcd088754.12E-92251434No hitNo description
SMARTSM002341.4E-24256465IPR002913START domain
PfamPF018523.2E-36256434IPR002913START domain
SuperFamilySSF559611.43E-23450620No hitNo description
SuperFamilySSF559611.43E-23652692No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 699 aa     Download sequence    Send to blast
MARMAENFET NVGRRSREED HESRSGSDNM DGASGDDQDA TDKPPRKKRY HRHTPQQIQE  60
LEALFKECPH PDEKQRMELS RRLCLETRQV KFWFQNRRTQ MKTQLERHEN SLLRQENDKL  120
RAENMSIRDA MRNPICSNCG GPTIIGEISL EEQHLRIENA RLKDELDRVC ALAGKFLGRP  180
ISSLANSVGP PLPNSSLELG VGSNGFGGLS TVATTLPLGP DFGVGISGGL PLVPPARSSA  240
GVTGLDRSIE RSMFLELALT AMDELVKLAQ TDEPLWVRSL EGGREILNHE EYMRSFTPCI  300
GLKQNGFVTE ASRETGMVII NSLALVETLM DSNRWAEMFP CMIAITSTTD VISSGMGGTR  360
NGALQLMHAE LQVLSPLVPV REVNFLRFCK QHAEGVWAVV DVSVDSIRET SGAPTFVNCR  420
RLPSGCVVQD MPNGTLAAIT ASGRRSMLKL AQRMTDNFCA GVCASTVHKW NKLNAGNVDE  480
DVRVMTRKSV DDPGEPPGIV LSAATSVWLP VSPQRLFDFL RDERLRSEWD ILSNGGPMQE  540
MAHIAKGQDH GNCVSLLRAS AMNPNQSSML ILQETCIDAA GSLVVYAPVD IPAMHVVMNG  600
GDSAYVALLP SGFAIVPDGP GSRGPSSNAN NSNSNANNGG GGGGGPGPHR VSGSLLTVAF  660
QILVNSLPTA KLTVESVETV NNLISCTVQK IKAALHCES
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022757219.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLW9QYS70.0W9QYS7_9ROSA; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
STRINGXP_010091553.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]