PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold14007-snap-gene-0.9-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family GeBP
Protein Properties Length: 272aa    MW: 30463.9 Da    PI: 5.1791
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold14007-snap-gene-0.9-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573123.88.2e-39125222198
                                    DUF573   1 klfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkv 69 
                                               klfqrlws+e ei lL+G++d++a +g++p +d  af+efvkks++++v+k qlv+K++rL+kK++++ 
  maker-scaffold14007-snap-gene-0.9-mRNA-1 125 KLFQRLWSDENEIELLKGMLDYTALRGADPAADAAAFFEFVKKSLHVEVTKAQLVDKMKRLRKKYNNNA 193
                                               579****************************************************************** PP

                                    DUF573  70 kkaksgkepsfskehdqkifelskkiWgs 98 
                                                + k+gk+p+fsk+h+qk++elskkiWgs
  maker-scaffold14007-snap-gene-0.9-mRNA-1 194 GRGKKGKDPTFSKPHEQKTYELSKKIWGS 222
                                               ***************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.2E-34127221IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MAPKRPSHLD DPPAASSSEE EEEEETSSED EEEEEEGESS SEEEEHKAEA AKIDSLPSTP  60
ATKPRSKPSS ARSSAATKKR PNGEAEATPS KRVKKKDPEP KSQDAVVSPS EDSKKGGGGG  120
GDEKKLFQRL WSDENEIELL KGMLDYTALR GADPAADAAA FFEFVKKSLH VEVTKAQLVD  180
KMKRLRKKYN NNAGRGKKGK DPTFSKPHEQ KTYELSKKIW GSSVWLDERV IKRGLKLIDE  240
EKKVELEERW KEVELAELEL FVKRTELIKD QA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023912590.14e-94probable transcription factor At4g00390 isoform X2
TrEMBLA0A2I4DEH02e-57A0A2I4DEH0_JUGRE; probable transcription factor At1g61730
STRINGGorai.013G021200.13e-50(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00390.11e-27DNA-binding storekeeper protein-related transcriptional regulator