PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold12065-snap-gene-0.6-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 468aa    MW: 52826.8 Da    PI: 5.2843
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold12065-snap-gene-0.6-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.51.1e-52161431128
                                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkk 67 
                                               l+pGfrFhPtdeelv +yLk+kv gk++++ ++i+evdiyk+ePwdL  k  +k++++ewyfFs  dkk
  maker-scaffold12065-snap-gene-0.6-mRNA-1  16 LAPGFRFHPTDEELVIYYLKRKVCGKPFRI-NAISEVDIYKSEPWDLAdKsGLKTRDQEWYFFSALDKK 83 
                                               579***************************.89**************75347788999*********** PP

                                       NAM  68 yatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                               y +g r nrat++gyWkatg+d++v++ ++++ glkktLvf++grap+g +t+Wvmheyrl
  maker-scaffold12065-snap-gene-0.6-mRNA-1  84 YGNGARMNRATNKGYWKATGNDRPVHH-ESRTAGLKKTLVFHSGRAPDGARTNWVMHEYRL 143
                                               ***************************.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-6013170IPR003441NAC domain
PROSITE profilePS5100558.12616169IPR003441NAC domain
PfamPF023659.2E-2718143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MRRETPSLPA PPPTALAPGF RFHPTDEELV IYYLKRKVCG KPFRINAISE VDIYKSEPWD  60
LADKSGLKTR DQEWYFFSAL DKKYGNGARM NRATNKGYWK ATGNDRPVHH ESRTAGLKKT  120
LVFHSGRAPD GARTNWVMHE YRLVDEELEK ARAGATMQDS YVLCRVFHKN NIGPPNSHRY  180
APFIEEEWDD SAPVLFLGEQ AGKEVVAVHN PCDVEAGYDA YAEEAGHDEC DEDAGNVVCA  240
KENGHYEYVE NGYVECVENR QDSFIEGNNF EQDTQSINEA PLSASEVPRE NQNALVVCKS  300
ERMDDYLSPC LANPRPSPLL RYKRRRHNES NSNHSNGLET STRTSQDHCS STTTTAATPL  360
TTTTTAPATT RNFLSALVEY SLLESIEPKD SLSVSPPFDI ANLDSSVPPS CLKFIQDLQN  420
EIHKISVERE TLKFELMSAQ TMLNILQSRI DLLNKENEDL KRSVRDVK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A5e-511517119170NAC domain-containing protein 19
3swm_B5e-511517119170NAC domain-containing protein 19
3swm_C5e-511517119170NAC domain-containing protein 19
3swm_D5e-511517119170NAC domain-containing protein 19
3swp_A5e-511517119170NAC domain-containing protein 19
3swp_B5e-511517119170NAC domain-containing protein 19
3swp_C5e-511517119170NAC domain-containing protein 19
3swp_D5e-511517119170NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00612ChIP-seqTransfer from AT3G10490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023879656.10.0NAC domain containing protein 50-like
TrEMBLA0A2I4DSM40.0A0A2I4DSM4_JUGRE; NAC transcription factor NAM-1-like
STRINGXP_010090441.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF81893241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10490.21e-117NAC domain containing protein 52