PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold11681-snap-gene-0.5-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family SBP
Protein Properties Length: 532aa    MW: 59052 Da    PI: 6.5497
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold11681-snap-gene-0.5-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.76e-42182257277
                                               -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT--- CS
                                       SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhn 70 
                                               Cqv gC++dls+ k+yh+rhkvC+vhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hn
  maker-scaffold11681-snap-gene-0.5-mRNA-1 182 CQVYGCNKDLSSSKDYHKRHKVCDVHSKTAKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHN 250
                                               ********************************************************************* PP

                                               ----S-- CS
                                       SBP  71 errrkkq 77 
                                               errrk+q
  maker-scaffold11681-snap-gene-0.5-mRNA-1 251 ERRRKPQ 257
                                               *****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.4E-32178243IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.359179256IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.47E-39180261IPR004333Transcription factor, SBP-box
PfamPF031101.3E-31182255IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 532 aa     Download sequence    Send to blast
MESWSYNSEG KGILFSDEMD FQIDGFARSR KTLMEWDNKH SYDFESNELG SDREVGESTE  60
FMELGFSDFV RKPFHGNQEV ETLSGGVGSG SSKRVVSPTC MITSTSCFGE VDSEAKLSSS  120
VMDACSQDSS LIDLKLGRLA DYEDAENSKL LKERPILSSS DGSSLLTKRA RKTSSYCQAA  180
FCQVYGCNKD LSSSKDYHKR HKVCDVHSKT AKVIVNGIEQ RFCQQCSRFH LLAEFDDGKR  240
SCRKRLAGHN ERRRKPQLDT LSGKSHKFLQ SYQGTRYLGT TMTKRTPYVF PDIFQSGVIY  300
PEKYEQANWL RNIKLEGESI CGPQSAIPIT SGQLLPKTFL HLHGIGKQCC SGVPSSGAED  360
YAVTASTVQE LSGASISSCA LSLLSAQSQD LSSHLTGIPI ASPQVMQDGF AHHSVGQISD  420
KPLRVNSMEQ YGPNGLYSYG MNSLEIDKMG SVMLSDTDHA ADFQVHSNGI FQESDILNAK  480
YCPSPEHAPT VNLLQLSSHL QRVERQRNSN EVKQENEDFC YFPTTRAVCN PQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-291812551084squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023917881.10.0squamosa promoter-binding-like protein 6
RefseqXP_023917882.10.0squamosa promoter-binding-like protein 6
TrEMBLA0A2N9EUH80.0A0A2N9EUH8_FAGSY; Uncharacterized protein
STRINGEOY016360.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.11e-52SBP family protein