PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold09973-snap-gene-0.11-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 452aa    MW: 52599.6 Da    PI: 9.8537
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold09973-snap-gene-0.11-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM78.51.5e-24168261128
                                        NAM  61 FskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                                   +++ky++g+r++r+t++gyWkatg dke+ + +g l glkktLvfykg+ ++g kt+W+mheyrl
  maker-scaffold09973-snap-gene-0.11-mRNA-1  16 KRAKERKYPNGSRPKRTTNNGYWKATGVDKEIRE-NGILRGLKKTLVFYKGEPQRGDKTKWIMHEYRL 82 
                                                457899***************************9.99*****************************98 PP

2NAM137.21.1e-421813062128
                                        NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkky 68 
                                                ppGfrF+Ptd elv++yLk++v +k+l++   + evd+y+ +P +L  ++++ +ek wyfF++r++ky
  maker-scaffold09973-snap-gene-0.11-mRNA-1 181 PPGFRFDPTDRELVKYYLKPRVLNKPLPE-LSFMEVDLYNQNPDTLAeQNLHYGEKVWYFFTPRNRKY 247
                                                8*************************999.4599************867888899************* PP

                                        NAM  69 atgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                                ++g+r+nra+ +gyW+a g d ++++ kg  +g kktL f +g+ pkgekt W+mhey++
  maker-scaffold09973-snap-gene-0.11-mRNA-1 248 QNGSRPNRAAGDGYWRANGADVQIKE-KGVIIGWKKTLNFMRGKPPKGEKTGWIMHEYKI 306
                                                *************************9.999****************************86 PP

3NAM29.42.2e-093874454496
                                        NAM  44 PwdLpkkvka....eekewyfFskrdkkyatgkrknratk..sgyWkatgkdkevlskk 96 
                                                P +L++ +k+    +e++wyfF+++++k+++gk k r ++  +gyW+ +g +k++++ k
  maker-scaffold09973-snap-gene-0.11-mRNA-1 387 PLTLDNLTKNhgleGENKWYFFTQTKRKHTKGKSKYRNIEvlDGYWEVSGAEKKIMKPK 445
                                                66665322222233778******************9976666*************9964 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100530.0751109IPR003441NAC domain
SuperFamilySSF1019412.09E-2818109IPR003441NAC domain
PfamPF023651.4E-102282IPR003441NAC domain
PROSITE profilePS5100546.153180324IPR003441NAC domain
SuperFamilySSF1019411.06E-47180313IPR003441NAC domain
PfamPF023654.4E-25181306IPR003441NAC domain
PROSITE profilePS5100511.404352452IPR003441NAC domain
SuperFamilySSF1019411.44E-6387446IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 452 aa     Download sequence    Send to blast
MNFFNQLFLT SLNIFKRAKE RKYPNGSRPK RTTNNGYWKA TGVDKEIREN GILRGLKKTL  60
VFYKGEPQRG DKTKWIMHEY RLVDAPIPTK RSANDMKLDD CVLCKIYNTN NRKSSEQDED  120
HPVVVSNINP TTQLPDIDPT TQLPQALNTE IISPGLSLEG REAIMNDLCK LEEEQLKGQN  180
PPGFRFDPTD RELVKYYLKP RVLNKPLPEL SFMEVDLYNQ NPDTLAEQNL HYGEKVWYFF  240
TPRNRKYQNG SRPNRAAGDG YWRANGADVQ IKEKGVIIGW KKTLNFMRGK PPKGEKTGWI  300
MHEYKINAPA PTKRSENDMR IYNKKDRIRN EDEDHSKDAS SISLPEDDRR ELMENFNSAG  360
QDYEDLSNNN KNMYKKRLFM SNFLSSPLTL DNLTKNHGLE GENKWYFFTQ TKRKHTKGKS  420
KYRNIEVLDG YWEVSGAEKK IMKPKTNIAA GY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-40730616170Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1311318TKRSENDM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022728756.16e-61NAC domain-containing protein 67-like
STRINGEOY327094e-55(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1730657
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.12e-46NAC domain containing protein 32