PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold09973-snap-gene-0.10-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 240aa    MW: 28348.6 Da    PI: 10.1031
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold09973-snap-gene-0.10-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM138.63.8e-43601852128
                                        NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka.eekewyfFskrdkky 68 
                                                ppGfrF+Ptd +lv++yL +kv +++l+  + i +v++y++ P+ L +++k+ ++++wyfF++r++ky
  maker-scaffold09973-snap-gene-0.10-mRNA-1  60 PPGFRFSPTDIDLVMHYLIRKVLNHPLPW-NRIVDVQLYDHSPEWLAEEYKQyGQNKWYFFTPRERKY 126
                                                8****************************.77**************8544443888************ PP

                                        NAM  69 atgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                                ++gk++nra+ +gyWkatg+d++++  k+ +vg kk L+fy+g+apkg kt+W+m+eyr+
  maker-scaffold09973-snap-gene-0.10-mRNA-1 127 RNGKHPNRAAGDGYWKATGTDTAIKF-KELVVGYKKKLIFYRGKAPKGDKTNWIMNEYRI 185
                                                *************************9.8999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-5248211IPR003441NAC domain
PROSITE profilePS5100548.31459211IPR003441NAC domain
PfamPF023651.5E-2360185IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MSMKEKVVDQ ARRLIGSCMN IELVILIWIN GLCVGFIIRG NQARHKLKRE YHSLEYVKPP  60
PGFRFSPTDI DLVMHYLIRK VLNHPLPWNR IVDVQLYDHS PEWLAEEYKQ YGQNKWYFFT  120
PRERKYRNGK HPNRAAGDGY WKATGTDTAI KFKELVVGYK KKLIFYRGKA PKGDKTNWIM  180
NEYRINHPPV TNTSESDMRL DKWVLCMIYQ KNESKSSETH TQKAYPTSSH ANDRNEPLKN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-51432141168NO APICAL MERISTEM PROTEIN
1ut4_B9e-51432141168NO APICAL MERISTEM PROTEIN
1ut7_A9e-51432141168NO APICAL MERISTEM PROTEIN
1ut7_B9e-51432141168NO APICAL MERISTEM PROTEIN
3swm_A1e-504921410171NAC domain-containing protein 19
3swm_B1e-504921410171NAC domain-containing protein 19
3swm_C1e-504921410171NAC domain-containing protein 19
3swm_D1e-504921410171NAC domain-containing protein 19
3swp_A1e-504921410171NAC domain-containing protein 19
3swp_B1e-504921410171NAC domain-containing protein 19
3swp_C1e-504921410171NAC domain-containing protein 19
3swp_D1e-504921410171NAC domain-containing protein 19
4dul_A9e-51432141168NAC domain-containing protein 19
4dul_B9e-51432141168NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023912168.11e-133NAC transcription factor 25-like
TrEMBLA0A2N9GNT01e-77A0A2N9GNT0_FAGSY; Uncharacterized protein
STRINGEOY327092e-68(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101121642
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15500.18e-53NAC domain containing protein 3