PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold09859-augustus-gene-0.11-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family WRKY
Protein Properties Length: 287aa    MW: 32188.7 Da    PI: 8.6468
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold09859-augustus-gene-0.11-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY91.94.9e-29358259
                                                   --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                                           WRKY  2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                                                   dDgynWrKYG K+vkgsef+rsYY+Ct++gCpvkk+ve+s  d++ v+i+Y+g+Hnhe
  maker-scaffold09859-augustus-gene-0.11-mRNA-1  3 DDGYNWRKYGLKQVKGSEFARSYYKCTFSGCPVKKRVEHSL-DGQ-VKIIYKGQHNHE 58
                                                   8****************************************.887.6899*******7 PP

2WRKY101.35.5e-32173231159
                                                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                                           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                                    ldDgy+WrKYGqK v+g+++pr YY+Ct+ gC+++k+ver+++dpkvv+ tYeg+Hnh+
  maker-scaffold09859-augustus-gene-0.11-mRNA-1 173 LDDGYRWRKYGQKIVRGNPYPRRYYKCTTLGCSARKHVERASSDPKVVISTYEGKHNHD 231
                                                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081122.102160IPR003657WRKY domain
SMARTSM007742.8E-30259IPR003657WRKY domain
SuperFamilySSF1182903.14E-22260IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.1E-24260IPR003657WRKY domain
PfamPF031062.2E-22358IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.0E-33163233IPR003657WRKY domain
SuperFamilySSF1182902.09E-28165233IPR003657WRKY domain
PROSITE profilePS5081137.172168233IPR003657WRKY domain
SMARTSM007742.7E-35173232IPR003657WRKY domain
PfamPF031063.4E-25174231IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
AADDGYNWRK YGLKQVKGSE FARSYYKCTF SGCPVKKRVE HSLDGQVKII YKGQHNHELP  60
QKRAKDTGNS NQGNPDFASQ VQSGNLNKLK EETCLYLMSK KDQESSQATS EHLSGTTNSE  120
VVDVAETGVD EKDEDEPESE RQSTEVRVLE PASSHRTVTE PRIVQTTSEV DLLDDGYRWR  180
KYGQKIVRGN PYPRRYYKCT TLGCSARKHV ERASSDPKVV ISTYEGKHNH DIPAAKSSSH  240
NTANSIASQS KPDKILPEKH SLINNMGLGN KWETYSINLG ILGKSHI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-403234878Probable WRKY transcription factor 4
2lex_A1e-403234878Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid and during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023880982.11e-174probable WRKY transcription factor 3
SwissprotQ9ZQ701e-108WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLA0A2I4FXJ51e-145A0A2I4FXJ5_JUGRE; probable WRKY transcription factor 4
STRINGEOY018121e-131(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF154534100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-110WRKY DNA-binding protein 3
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Aamir M, et al.
    Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach.
    Front Plant Sci, 2017. 8: p. 819
    [PMID:28611792]