PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold09377-augustus-gene-0.7-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family WRKY
Protein Properties Length: 603aa    MW: 66653.5 Da    PI: 7.2373
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold09377-augustus-gene-0.7-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.62.7e-33261318260
                                                   --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                                          WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                                                   dDgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  d++++ei+Y+g+Hnh+k
  maker-scaffold09377-augustus-gene-0.7-mRNA-1 261 DDGYNWRKYGQKQVKGSENPRSYYKCTYPNCPTKKKVERSL-DGQITEIVYKGSHNHPK 318
                                                   8****************************************.***************85 PP

2WRKY106.61.3e-33431489159
                                                   ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                                          WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                                   ldDgy+WrKYGqK+vkg+++prsYY+Ct++gCpv+k+ver+++d ++v++tYeg+Hnh+
  maker-scaffold09377-augustus-gene-0.7-mRNA-1 431 LDDGYRWRKYGQKVVKGNPNPRSYYKCTHPGCPVRKHVERASHDLRAVITTYEGKHNHD 489
                                                   59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.2E-28251319IPR003657WRKY domain
SuperFamilySSF1182901.83E-25259319IPR003657WRKY domain
SMARTSM007741.3E-36260318IPR003657WRKY domain
PROSITE profilePS5081123.824261319IPR003657WRKY domain
PfamPF031061.3E-25261317IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.0E-37416491IPR003657WRKY domain
SuperFamilySSF1182901.27E-29423491IPR003657WRKY domain
PROSITE profilePS5081138.147426491IPR003657WRKY domain
SMARTSM007741.2E-39431490IPR003657WRKY domain
PfamPF031065.3E-26432489IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009753Biological Processresponse to jasmonic acid
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 603 aa     Download sequence    Send to blast
MASSSGSLDT SANSHPASFT FSTHPFMTTS FSDLLASPND IDDQNTTLEN RNRSLSDRIA  60
ERTGSGVPKF KSIPPPSLPI SPPAVSPSSY FAIPAGLSPA ELLDSPVLLN ASHILPSPTT  120
GTFPAQAFNW RSNFSNQQQN VKQENKNYSD FSFQTQQRPP LSSTTNYQPS NTAIQTVQPQ  180
AWSFQEPTKQ DEFSTGKSMV KAEFGSMQGY SSDITTITSN IQSNNNNNNN SNNGGLQSEY  240
GNYHQQPQQP QQPQTLSRRS DDGYNWRKYG QKQVKGSENP RSYYKCTYPN CPTKKKVERS  300
LDGQITEIVY KGSHNHPKPQ STRRSSSASS HAIQVSNSSS HELHDQSYAA LGNGHMDSVA  360
TPENSSISMG DEDFDQSSQK SKSAGDDYDE DEPDAKRWKK EGENEGISAA GSRTVREPRV  420
VVQTTSDIDI LDDGYRWRKY GQKVVKGNPN PRSYYKCTHP GCPVRKHVER ASHDLRAVIT  480
TYEGKHNHDV PAARGSGSHS VNRPLPSNNN NNISAATAIR PSAITHHTNN SVNNHHLHNL  540
RLPTSEGQAP FTLEMLQSPE SFGFSSFGNA IGSYMNQQQV TDNVYSRTKE EPRDDMFFES  600
LLA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-37261492878Probable WRKY transcription factor 4
1wj2_A1e-37261492878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007208290.10.0hypothetical protein PRUPE_ppa003333mg
SwissprotQ8S8P51e-113WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLM5W7170.0M5W717_PRUPE; Uncharacterized protein
STRINGGLYMA14G38010.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF107734114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-109WRKY DNA-binding protein 33