PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold08573-augustus-gene-0.8-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 531aa    MW: 58686.3 Da    PI: 4.5589
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold08573-augustus-gene-0.8-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM123.91.3e-38201423128
                                           NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdk 66 
                                                   pG+rF+Ptd elv+++L +kv g+k++   vi+evd+ykv PwdLp k++ +++ +wyf ++ +k
  maker-scaffold08573-augustus-gene-0.8-mRNA-1  20 PGVRFNPTDVELVMFFLLRKVMGRKCPK--VIAEVDVYKVSPWDLPdKSIVKGDLKWYFLCPIEK 82 
                                                   9************************888..9***************777778888********** PP

                                           NAM  67 kyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                                   ky+ g r nrat+ g Wk tg++++v+  +++lvg  ktL+f+ g+ap  ++tdWv+heyrl
  maker-scaffold08573-augustus-gene-0.8-mRNA-1  83 KYSAGVRMNRATDVGHWKITGNERHVHY-NNTLVGSIKTLIFHMGKAPG-KRTDWVIHEYRL 142
                                                   ***************************9.999***********999986.9*********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-4615165IPR003441NAC domain
PROSITE profilePS5100544.74918165IPR003441NAC domain
PfamPF023652.7E-1920142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 531 aa     Download sequence    Send to blast
MESGNSGLGH LMGKELFPFP GVRFNPTDVE LVMFFLLRKV MGRKCPKVIA EVDVYKVSPW  60
DLPDKSIVKG DLKWYFLCPI EKKYSAGVRM NRATDVGHWK ITGNERHVHY NNTLVGSIKT  120
LIFHMGKAPG KRTDWVIHEY RLDDKYLAER GVAQNGHVLC MIYHKEGLGP KNNAQYGAPF  180
KEEDWNDDEE VGFVEVVSSG FPTPASVLPN NYSSSLAAGT SQCDGTASES FLSETVLSER  240
EVHPAVHSIN VVSKEFNQVF DGDEEVGFVE VVSSGFPTPA SVLSNNYSSS LAAGTSQCDG  300
TASESYLFET VLSEREVHPA VHSINVVSKE FNQVYDGDVT FSTSVVLIED KKNKNPIHDG  360
TDEAALPVDE STICKDLGDP VNTARLSEGG YDFSTGSPDN CLYMGDLRKP LPPEAGESQH  420
VSTNLYPGYN ANIHSELISL SSCDADKNVS HNGLAELLSD ETEIFEGLGD LGTTYRQGCN  480
FPTSFLDDFI SLEDIETEAG EPQQVSNLYQ MVFPNQKERK RKRQEDNDEI K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-352016617169Stress-induced transcription factor NAC1
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00583DAPTransfer from AT5G64060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023884335.10.0NAC domain-containing protein 82-like
TrEMBLA0A2N9IIN81e-147A0A2N9IIN8_FAGSY; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33023465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09330.43e-70NAC domain containing protein 82