PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold08297-augustus-gene-0.5-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 191aa    MW: 22082.4 Da    PI: 8.045
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold08297-augustus-gene-0.5-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM128.94e-4081641128
                                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk................ 49 
                                                   lppGfrF+Ptd+el+ ++Lk+k++g++ ++  +++e+d yk+ePwd+++                
  maker-scaffold08297-augustus-gene-0.5-mRNA-1   8 LPPGFRFSPTDKELIERFLKRKITGNDKDI-YFVPEIDFYKLEPWDIQRnllifiithppsflgy 71 
                                                   79*************************999.78**************95599************* PP

                                           NAM  50 ................kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                                                                    ++++++ew+ F + + + ++g+rknr+t +g+ katgkd+e++s +g+
  maker-scaffold08297-augustus-gene-0.5-mRNA-1  72 cvlccqslalwnvdicGIDTKDQEWFCFNPPSLN-QNGNRKNRTTMEGFYKATGKDREIKS-RGS 134
                                                   ******99999998887777999******99875.68************************.999 PP

                                           NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                                                   l+g+kktLv+++gr+p+ge t+Wvmheyr 
  maker-scaffold08297-augustus-gene-0.5-mRNA-1 135 LIGMKKTLVYHRGRTPNGEGTKWVMHEYRT 164
                                                   ****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-15556IPR003441NAC domain
PROSITE profilePS5100538.1418189IPR003441NAC domain
PfamPF023657.3E-239163IPR003441NAC domain
SuperFamilySSF1019414.18E-2583171IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MGKLSLDLPP GFRFSPTDKE LIERFLKRKI TGNDKDIYFV PEIDFYKLEP WDIQRNLLIF  60
IITHPPSFLG YCVLCCQSLA LWNVDICGID TKDQEWFCFN PPSLNQNGNR KNRTTMEGFY  120
KATGKDREIK SRGSLIGMKK TLVYHRGRTP NGEGTKWVMH EYRTTQDEFD GTHPGQVGFC  180
FSVCLIDVIL T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-3021639139Stress-induced transcription factor NAC1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023872460.13e-53NAC domain-containing protein 62-like
TrEMBLA0A2N9EGM83e-50A0A2N9EGM8_FAGSY; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2516523
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33060.11e-45NAC 014