PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold07746-snap-gene-0.12-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family MYB_related
Protein Properties Length: 326aa    MW: 35752.1 Da    PI: 9.3757
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold07746-snap-gene-0.12-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.42.8e-1266110147
                                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                                r +WT+ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  maker-scaffold07746-snap-gene-0.12-mRNA-1  66 RESWTEPEHDKFLEALQLFDRD-WKKIEAFIG-SKTVIQIRSHAQKY 110
                                                789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.65E-1660116IPR009057Homeodomain-like
PROSITE profilePS5129414.11461115IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.0E-663116IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-1864113IPR006447Myb domain, plants
SMARTSM007179.6E-1065113IPR001005SANT/Myb domain
PfamPF002496.3E-1066110IPR001005SANT/Myb domain
CDDcd001671.39E-768111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MVSKNPNPTE SFYLDPNGMA LPGLGPFATT TATNATTATT SAASTTSSAE DLSKKIRKPY  60
TMTKSRESWT EPEHDKFLEA LQLFDRDWKK IEAFIGSKTV IQIRSHAQKY FLKVQKSGTS  120
EHLPPPRPKR KAAHPYPQKA SKNVPVLSQL SGSFQTSSGL LESGYVLSPD SPSMLRSPIT  180
SAGVSPWTKN TVQTVNVSHG TQGPTVANNS CSSTESTPRA QAIAESTDKG NHNHPLRVLP  240
DFSQVYRFIG SVFDPNAAGH LQKLKKMDPI DVETVILLMR NLSINLSSPD FEEHRRLLSS  300
YEIDTDATNY GNAEKALYKD QPETVA
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00625PBMTransfer from PK02532.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023926889.10.0protein REVEILLE 6
SwissprotQ8H0W31e-135RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A2I4GTR71e-178A0A2I4GTR7_JUGRE; protein REVEILLE 6 isoform X1
STRINGEOY233251e-167(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.11e-121MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]