PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold07605-snap-gene-0.12-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family HB-other
Protein Properties Length: 1661aa    MW: 187320 Da    PI: 5.6076
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold07605-snap-gene-0.12-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox38.81.6e-124392257
                                               SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                                   Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                                               + yps+++r+eL++klgL++rq ++WF+ rR k+kk
  maker-scaffold07605-snap-gene-0.12-mRNA-1  4 ETYPSEATRAELSEKLGLSDRQLQMWFCHRRLKDKK 39
                                               67********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003890.0083144IPR001356Homeobox domain
PROSITE profilePS5007113.491140IPR001356Homeobox domain
SuperFamilySSF466893.64E-9443IPR009057Homeodomain-like
PfamPF000465.0E-10439IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.1E-11539IPR009057Homeodomain-like
CDDcd000862.29E-8639No hitNo description
PROSITE profilePS5082716.697526585IPR018501DDT domain
SMARTSM005717.4E-22526585IPR018501DDT domain
PfamPF027912.6E-17527582IPR018501DDT domain
PfamPF050665.2E-15708776IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156123.5E-8858902IPR028942WHIM1 domain
PfamPF156132.2E-1210421114IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1661 aa     Download sequence    Send to blast
MEVETYPSEA TRAELSEKLG LSDRQLQMWF CHRRLKDKKD GSAKKPRKSA STAVVAAMPE  60
SPVDELRGGG EPGSDYGSGS GSGSGSSPLG RSEFRNAVSR SVLDDVPIMR RYYESPQSIL  120
ELRAIACVEA QLGEPLREDG PILGVEFDSL PPDAFGAPIG MAIAVSEQPK RLGHPYEGKL  180
YEQRDVKSYK CKVEVEVVGP RPTQATQRAL HEYPFLHDQP GARPDAFGQV SQSHFHDSML  240
DAPTARTSSV VHGNEQLPRV HGVQGHVPRV RIFPQQEKQA LALSSPPRDD ERVPQRESLT  300
NVRVSSQFGD HPIIGPEDSY VLSDGQISHS EAILRMEKKR KSEEARIAKE VEAHEIRIRK  360
ELEKQDILRR KNEERMKKEM EKQDRERKKE EERLMRERQR EEERSKREQK REMERREKFL  420
QKENLRAEKR RQKEELRKEK EAVRRKAAIE KATARRIARE SMELIEDEQL ELMELAVASK  480
GLSSMIHLDH DTLQNIESFR DLLSAFPPKS VKLKKPFAVQ PWINSEENIG NLLMVWRFLI  540
TFADVLKLWP FTLDEFVQAF HDYDSRLLGE IHLALLKLII KDIEDVARTP STGLVVNQNG  600
AANPGGGHPQ IVEGAYAWGF DIRNWQRHLN PLTWPEIFRQ LALSAGFGPQ LKKRSVRWSY  660
SHENDEGKGC EDIVSTLRNG SAAENAFAIM QEKGLLLPRR SRHRLTPGTV KFAAFHVLSL  720
EGGKGLTVLE LADKIQKSGL RDLTTSKTPE ASISVALTRD AKLFERIAPS TYRVRAAFRK  780
DPADAEAILS AARKKIQIFE NGFLAEDAEY TELEKDFSSI PLAGPKDENC PSTASELCVV  840
GGGISAVNQE NMEIDESKSG ESWIQGLTEG DYSDLSVEER LNALVTLIGV ANEGNSIRGV  900
LEDRMESANA LKKQMWAEAQ LDKSRLKEEI ISKADFSSSI TGSRAEMQFL SSAVEGSQSP  960
FPNVDNQLIE ASPSTAENQN PLVSQGIQDH LNNVPTERTP GQDFPTGPDN FLIQQLGYAS  1020
KRSRSQLKSY IAHRAEEMYV YRSLPLGQDR RRNRYWQFVA SASSNDPGSG RIFIELHDGN  1080
WRLIDSEEAF DALLISLDAR GIRESHLRLM LQKIESSFKE NVQRNMPSAN VVGRSGTMVK  1140
NEADEMTSSP DCPAGFDSPS STVCGLNSDM LETSSSFRIE LGRNETEKKA ALNRYQDFQK  1200
WTWKECFNSV TLCAMKYGKK RCSQLLGVCD FCLNCYLSED SHCLSCHRSF GTSNNDFNFS  1260
EHAIQCEEKR KIHMGSFQIL DSSLPLGTRL LKSLLAFIEV SVPPEALQSY WMGDHRKTWG  1320
VKLNASSSVE DLLQRVLKRD FLSSNFATTE ELLGSCTQSG SSLHDFSDPR SIPVLPWIPQ  1380
TMTAVALRLF ELDASVIYLK QEKPEPFEDK EVREYIKLPS RYAPFDNVKE VELTELNHDE  1440
KNFTELKSNR NSYKRGRGGR EQGRGKKWQK KARVSYSEVG RRNVKSNENL IQGLRQQGQR  1500
TYGQGSGRGR RTVRRRRVEK RAVDERLPSH RADTYRPKSI DDSPRNLGEE WDDERISMHP  1560
MEDPNFNDAE AVDSDDNAQA VEYEHGNWEI GFASASNGWR EDLNEASDED VDASEDDNVI  1620
EEAGDEDSEA DVDMSDGSDG ITNRVGNDEG SESADSDDYS D
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13239RRLKDKKD
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator required for the maintenance of the plant vegetative phase. In association with CHR11 or CHR17 may prevent the early activation of the vegetative-to-reproductive transition by regulating key genes that contribute to flower timing, such as FT, SEP1, SEP3, AGL8/FUL, SOC1 and FLC. {ECO:0000269|PubMed:22694359}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4508503e-47AM450850.2 Vitis vinifera contig VV78X157592.9, whole genome shotgun sequence.
GenBankAM4717623e-47AM471762.2 Vitis vinifera contig VV78X270915.11, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018811588.10.0PREDICTED: homeobox-DDT domain protein RLT1 isoform X1
SwissprotF4HY560.0RLT1_ARATH; Homeobox-DDT domain protein RLT1
TrEMBLA0A2N9G7460.0A0A2N9G746_FAGSY; Uncharacterized protein
STRINGEMJ158080.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25233369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28420.10.0homeobox-1