PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold07459-snap-gene-0.9-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 544aa    MW: 60620.7 Da    PI: 5.129
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold07459-snap-gene-0.9-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.94e-53111371127
                                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkk 67 
                                               lp GfrF+Ptd+el+++yL++k++g++ ++ +vi+e+d++k+ePw+Lp+  ++++++ ew++F+++d+k
  maker-scaffold07459-snap-gene-0.9-mRNA-1  11 LPLGFRFSPTDKELIDYYLRRKINGNERDV-SVIREIDVCKCEPWELPHfsAIDTKDPEWFYFCPQDRK 78 
                                               699************************999.99***************4347778888*********** PP

                                       NAM  68 yatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                                               y++g+r nrat++gyWkatgkd+e++s k+ l+g+kktLvfy+grap+g +t+Wvmheyr
  maker-scaffold07459-snap-gene-0.9-mRNA-1  79 YPNGSRLNRATRAGYWKATGKDREIKS-KKDLIGMKKTLVFYRGRAPRGARTNWVMHEYR 137
                                               ***************************.999****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-595161IPR003441NAC domain
PROSITE profilePS5100556.00211161IPR003441NAC domain
PfamPF023656.7E-2712137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009814Biological Processdefense response, incompatible interaction
GO:0010200Biological Processresponse to chitin
GO:0070417Biological Processcellular response to cold
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 544 aa     Download sequence    Send to blast
MAQAVISMNS LPLGFRFSPT DKELIDYYLR RKINGNERDV SVIREIDVCK CEPWELPHFS  60
AIDTKDPEWF YFCPQDRKYP NGSRLNRATR AGYWKATGKD REIKSKKDLI GMKKTLVFYR  120
GRAPRGARTN WVMHEYRPTL EELDGTKPGQ RAFVICRLFK KQDLSIEVSN HDEAAVSPED  180
TQLELDPVSP SLGGQAVNDP TSVECFPAEN SDASTSDTVA PVNCNEGNSD VAENQGGELP  240
ENDPKLEDDL RMFLDPPFEP QDWIPFSPSH MQIQELGQSY APNDLNSGKD GATSQSGPNE  300
QDDIAAFLDS VIRDPDEYSD AEVVNALHFQ GSLRSEDIID RKAPLQNPIS SSAASEQMYD  360
YILKESSNHL TAASSGEVRT GITIRHRPQI IQPGIENSMA QGSAPRRIRL QCKLQVQPLS  420
SNLVPEDRRY TTGDHELKPV DTDEENTSEK HAVAGDHSAA AATSAFSEPQ NILSNSIENY  480
KTSHPRSILK FNSRSNLTGF LAASLFPKAS SVRRSNLSLA ILFRVVLVAV LFISFASIWR  540
SVKL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-44616212166NO APICAL MERISTEM PROTEIN
1ut4_B2e-44616212166NO APICAL MERISTEM PROTEIN
1ut7_A2e-44616212166NO APICAL MERISTEM PROTEIN
1ut7_B2e-44616212166NO APICAL MERISTEM PROTEIN
4dul_A2e-44616212166NAC domain-containing protein 19
4dul_B2e-44616212166NAC domain-containing protein 19
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00398DAPTransfer from AT3G49530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018842746.11e-146PREDICTED: NAC domain-containing protein 62-like
TrEMBLA0A2N9EGR20.0A0A2N9EGR2_FAGSY; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55513353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49530.11e-92NAC domain containing protein 62