PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold06937-snap-gene-0.11-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family GATA
Protein Properties Length: 367aa    MW: 41116.5 Da    PI: 5.0071
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold06937-snap-gene-0.11-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.63.4e-18285318134
                                       GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                                                Cs+C++ kTp+WR gp g ktLCnaCG++y++ +
  maker-scaffold06937-snap-gene-0.11-mRNA-1 285 CSHCQVQKTPQWRTGPLGAKTLCNACGVRYKSGR 318
                                                *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169924.1E-7624366IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.385279315IPR000679Zinc finger, GATA-type
SMARTSM004017.6E-14279333IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.03E-14282342No hitNo description
Gene3DG3DSA:3.30.50.102.0E-14283316IPR013088Zinc finger, NHR/GATA-type
CDDcd002027.17E-15284341No hitNo description
PfamPF003204.7E-16285318IPR000679Zinc finger, GATA-type
PROSITE patternPS003440285310IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MEYCVDVRAL KSSLRREILP MKPTTQVFED FRASIGVASD DFPVDDLLDL SNAEFEDGYF  60
VENEEEEEEE EKDFLSVSSS QDDENSNSNS NSNSYNFSGT SESEFTLASG LAVPDDDLAG  120
LEWVSHFVDD SISEFSLFYP VGKQKIEANA MDRSEPESRP VLDRASCLPL EVPFPSKARS  180
KRSRTSNRVW SLPSSRFWDS NPSSPREEDQ AVLLDHKTLN FYDTSSLSSS GSCSSGLSSS  240
PRFFSGLPSS PSVFTMFNFV EPAKKKQKKK PAVQTGSGTQ FQRRCSHCQV QKTPQWRTGP  300
LGAKTLCNAC GVRYKSGRLF PEYRPACSPT FSGEIHSNSH RKVLEMRKRK EVVPEPESRL  360
NQMVSSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008236855.11e-101PREDICTED: GATA transcription factor 5-like
RefseqXP_008236856.11e-101PREDICTED: GATA transcription factor 5-like
TrEMBLD9ZIZ04e-98D9ZIZ0_MALDO; GATA domain class transcription factor
STRINGPOPTR_0009s12620.11e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.21e-43GATA transcription factor 5