PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold06382-augustus-gene-0.13-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family LBD
Protein Properties Length: 164aa    MW: 18468.9 Da    PI: 7.3399
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold06382-augustus-gene-0.13-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260118.44.1e-3761051100
                                         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvye 64 
                                                    +CaaCk lrr+C+kdCvlapyfp ++p++fa+vhk+FGasn +k+l++lp + r  a++++ +e
  maker-scaffold06382-augustus-gene-0.13-mRNA-1   6 RCAACKSLRRRCSKDCVLAPYFPPTNPQRFACVHKIFGASNTTKMLEQLPLHLRAVAADCMSFE 69 
                                                    6*************************************************************** PP

                                         DUF260  65 AearardPvyGavgvilklqqqleqlkaelallkee 100
                                                    A  r++dPv+G+v++i++lq+q+ ++++el+++k e
  maker-scaffold06382-augustus-gene-0.13-mRNA-1  70 ASSRVEDPVNGSVRIISQLQEQIIEAQSELVKTKGE 105
                                                    ******************************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.8585106IPR004883Lateral organ boundaries, LOB
PfamPF031958.1E-366102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MSNSTRCAAC KSLRRRCSKD CVLAPYFPPT NPQRFACVHK IFGASNTTKM LEQLPLHLRA  60
VAADCMSFEA SSRVEDPVNG SVRIISQLQE QIIEAQSELV KTKGEIAFHN AQQQQMQQLQ  120
MIHAIAQEGK DQPSWLSSSQ QDPFPNVNQQ LLEDYNYSNT FCGF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-32710612111LOB family transfactor Ramosa2.1
5ly0_B4e-32710612111LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023892508.11e-105LOB domain-containing protein 24-like
SwissprotP594684e-42LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A1U8B9X85e-60A0A1U8B9X8_NELNU; LOB domain-containing protein 24-like
STRINGXP_010278070.18e-61(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.11e-43LOB domain-containing protein 24