PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold06270-snap-gene-0.13-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family HB-other
Protein Properties Length: 521aa    MW: 59379.9 Da    PI: 7.3643
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold06270-snap-gene-0.13-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.37.4e-202479257
                                               T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                                   Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                                               +kR+  t+ q+ +Le+++++++yp++e++ +LA++lgLte+q++ WF+ rR k+kk
  maker-scaffold06270-snap-gene-0.13-mRNA-1 24 KKRRLKTPAQVMALERFYNEHKYPTEEMKSQLAEQLGLTEKQISGWFCHRRLKDKK 79
                                               8999**************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.3E-22779IPR009057Homeodomain-like
PROSITE profilePS5007117.4752080IPR001356Homeobox domain
SuperFamilySSF466891.37E-182288IPR009057Homeodomain-like
SMARTSM003897.4E-202284IPR001356Homeobox domain
CDDcd000861.20E-172479No hitNo description
PfamPF000462.6E-172479IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 521 aa     Download sequence    Send to blast
MSIIYLESSE VHSEENKVSS EKDKKRRLKT PAQVMALERF YNEHKYPTEE MKSQLAEQLG  60
LTEKQISGWF CHRRLKDKKL LRDEACASGR QDRSSVVIQD RGSGLGQDSC GSTKHGDYRN  120
IDPREVESRR LYGNDFQVSD LTYKHMSHYT ETVSGTDDTS SESSSSSQDK LFSQTEDPYD  180
VENSRYLTHN GVIAPINAKS AKIMGYKPSG YLKVKGEIEN AAITAVKRQL GGHYREDGPP  240
LGVEFQPLPP GAFESPIQKP VREQYYDEDL SIPNSPDISG AERQPSLSNG YEPYNSKLSS  300
QDLYMEEANN SGMHGSHYQD KISQLKQKST VLNHVKPFPK QNSSLDLYED SAGETSVYNS  360
KRNQRMSTKH GVEGMRIDSV TNHRGHYDGK IESEMHDYAN VSPNVIQRSE YFKFKPPNLI  420
HNRFESLDTE ERGLSTRMKK EEKVNRKWKG IKEHGNQVKL KMHSTNDIKV PKRVRHDLLQ  480
QDYVTKAPFT EMQTRKFLSK GSVMEMPSSF SEDETAENSS S
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12328KKRRLK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3956358e-45FQ395635.1 Vitis vinifera clone SS0AFA14YN23.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023876455.10.0homeobox-DDT domain protein RLT1
TrEMBLA0A2N9FN460.0A0A2N9FN46_FAGSY; Uncharacterized protein
STRINGVIT_06s0009g03530.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF57923051
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.11e-105HB-other family protein