PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold06127-augustus-gene-0.14-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family GATA
Protein Properties Length: 384aa    MW: 42509.4 Da    PI: 5.9177
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold06127-augustus-gene-0.14-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.71.6e-18300334135
                                           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                                                    Cs+Cg+ kTp+WR gp g ktLCnaCG+++++ +l
  maker-scaffold06127-augustus-gene-0.14-mRNA-1 300 CSHCGVQKTPQWRTGPLGAKTLCNACGVRFKSGRL 334
                                                    *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.2E-15294348IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.767294330IPR000679Zinc finger, GATA-type
SuperFamilySSF577165.7E-14296357No hitNo description
Gene3DG3DSA:3.30.50.101.8E-14298332IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.37E-14299348No hitNo description
PROSITE patternPS003440300325IPR000679Zinc finger, GATA-type
PfamPF003202.3E-16300334IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MLYRTHHPFF FQFHTFTSSN PPSSAPTTTT ITTSLPSLPF QTYRSVQGET EMECVEAALK  60
TSFRKEMALK PTPQVASEEL WAVKEQNGVA CDDFFVDELL DLSNEDGFVK DEQEEEEKDK  120
SFVSVSSEQD NENSNTKTTT FTASKDEFGS VPTSELGVPA DELADLEWLS HFVEDSFSEF  180
SEPYPTVILT DNPKVPEPEP EPEKPCFKTP VPARARSKRT RTGGRVWSLG SPSLTESSSS  240
STTTSSSSSS SPSSPWLIYV NPGQNLEPAE PVYAEAQPRV KKQKKKLKET GGGTQTPRRC  300
SHCGVQKTPQ WRTGPLGAKT LCNACGVRFK SGRLLPEYRP ACSPTFSNEL HSNHHRKVLE  360
MRRKKEVPAV TTQSSLAPAV VPSF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1279286VKKQKKKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008241780.11e-138PREDICTED: GATA transcription factor 5-like
SwissprotQ9FH572e-89GATA5_ARATH; GATA transcription factor 5
TrEMBLM5WGI31e-130M5WGI3_PRUPE; Uncharacterized protein
STRINGGLYMA01G37450.11e-110(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.22e-81GATA transcription factor 5