PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold05960-snap-gene-0.12-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family bZIP
Protein Properties Length: 207aa    MW: 23394.5 Da    PI: 8.8223
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold05960-snap-gene-0.12-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.76e-1475133563
                                                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                                     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                                ++ +r+++NRe+ArrsR RK++ ++ L   v+eL +eN++ +++++  ++++ + ++e+
  maker-scaffold05960-snap-gene-0.12-mRNA-1  75 RKRKRMISNRESARRSRMRKQKHLDDLVAQVAELRKENHQIIQNVSITTQHYRNIETEN 133
                                                6789***************************************9999999998887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.3E-1771135IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.59973136IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.8E-1175123No hitNo description
PfamPF001702.8E-1175133IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.08E-1275127No hitNo description
CDDcd147023.58E-2276127No hitNo description
PROSITE patternPS0003607893IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MSPILSEILL SGCMINSTFR RRTHLVQSFS VVFLYWFYKL CCGFNMASSS GTSSGSSLLQ  60
NSGSEEELQA LMDQRKRKRM ISNRESARRS RMRKQKHLDD LVAQVAELRK ENHQIIQNVS  120
ITTQHYRNIE TENSILRAQA SELSHRLQAL NDIINFLNAN TGVFGAAGVG DSSTFSPEPI  180
DSFLNPLSLS YLNQPIMATA DIFSQYY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17495RKRKRMISNRESARRSRMRKQK
28794RRSRMRKQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the DNA G-box motif 5'-CACGTG-3' of MAN7 promoter. Involved in the positive regulation of seed germination through MAN7 gene activation. MAN7 is required for both, loosening of the micropylar endosperm, and rupture of the seed coat in germinating seeds. {ECO:0000269|PubMed:23461773}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00239DAPTransfer from AT1G75390Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023909091.19e-88bZIP transcription factor 44
SwissprotC0Z2L54e-51BZP44_ARATH; bZIP transcription factor 44
TrEMBLA0A2N9J6P61e-82A0A2N9J6P6_FAGSY; Uncharacterized protein
STRINGGorai.005G245700.11e-79(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61334147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.14e-50basic leucine-zipper 44
Publications ? help Back to Top
  1. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  2. Pedrotti L, et al.
    Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
    Plant Cell, 2018. 30(2): p. 495-509
    [PMID:29348240]