PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold05469-snap-gene-0.9-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 325aa    MW: 37262.9 Da    PI: 7.0056
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold05469-snap-gene-0.9-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM56.31.1e-171259149
                                       NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49
                                              lppGfrFhP+deel+++yL++kv++++l++ ++i+e+d+yk++Pw+Lp+
  maker-scaffold05469-snap-gene-0.9-mRNA-1 12 LPPGFRFHPSDEELIQHYLRNKVTSSPLPA-SIIAEIDLYKYNPWELPM 59
                                              79****************************.89**************94 PP

2NAM62.61.2e-196011673128
                                       NAM  73 rknratksgyWkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                               r+nra+  gyWkatg+dk+ l++ +++ +g+kk L+fykgr pkg+ktdW+mheyr 
  maker-scaffold05469-snap-gene-0.9-mRNA-1  60 RPNRAAGLGYWKATGTDKPTLTScGTKSIGVKKALAFYKGRPPKGVKTDWIMHEYRS 116
                                               89*****************999978889***************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-459144IPR003441NAC domain
PROSITE profilePS5100532.212144IPR003441NAC domain
PfamPF023653.8E-2113115IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MENQQPTSDI RLPPGFRFHP SDEELIQHYL RNKVTSSPLP ASIIAEIDLY KYNPWELPMR  60
PNRAAGLGYW KATGTDKPTL TSCGTKSIGV KKALAFYKGR PPKGVKTDWI MHEYRSSLDT  120
MIWTAKAKGS MRLDDWVLCR VRQKCGVLRN VREDRYGPSY EPPVYVQKVD EPWSMNVHPT  180
LFAAVRNYLY NDCSMLPYFF ASQKIPCTDT TANISFQSNN GGKLYPKDDT AINQSQYLAS  240
FNSLIFVFPS KKVSNKDNEE VEISQRNDST AGMKFCGTDP PQDNDFDAAH EWSSFNPYQE  300
LDDQFVFTES SNKLEQWREG YVANY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-47814411168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023893514.10.0NAC domain-containing protein 2-like
TrEMBLA0A2N9FD871e-134A0A2N9FD87_FAGSY; Uncharacterized protein
STRINGEMJ074231e-105(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24162981
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.13e-57NAC-like, activated by AP3/PI