PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold05403-augustus-gene-0.18-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 199aa    MW: 22656.2 Da    PI: 8.4727
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold05403-augustus-gene-0.18-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM136.32e-42471721128
                                            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFs 62 
                                                    lppGfrF+Ptd+el+  +Lk+k++g++ ++  +++ev+ yk+ePwdL+ k  ++++++ew+fF+
  maker-scaffold05403-augustus-gene-0.18-mRNA-1  47 LPPGFRFSPTDKELIELFLKPKITGNDEDI-YFVPEVEFYKLEPWDLQyKsGIDTKDQEWFFFA 109
                                                    79*************************999.78**************95247777999****** PP

                                            NAM  63 krdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmhey 126
                                                     ++ ++++gk +nr+t++g Wk tg+d+e++s kg+++g+kktLvf+ gr++kg  t+Wvmhey
  maker-scaffold05403-augustus-gene-0.18-mRNA-1 110 AQSLQHQKGKGRNRKTEKGHWKVTGNDREIKS-KGKVIGMKKTLVFHIGRSRKG--TKWVMHEY 170
                                                    ********************************.999*****************7..9******* PP

                                            NAM 127 rl 128
                                                    r 
  maker-scaffold05403-augustus-gene-0.18-mRNA-1 171 RT 172
                                                    96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-4743179IPR003441NAC domain
PROSITE profilePS5100542.8447197IPR003441NAC domain
PfamPF023651.8E-2548171IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MHAKVTTCGT SCADDMKQGV DSPLATKYNA SCVCVCECVM EKLSLDLPPG FRFSPTDKEL  60
IELFLKPKIT GNDEDIYFVP EVEFYKLEPW DLQYKSGIDT KDQEWFFFAA QSLQHQKGKG  120
RNRKTEKGHW KVTGNDREIK SKGKVIGMKK TLVFHIGRSR KGTKWVMHEY RTTLKDLDGT  180
HPGQVGLLYS VCLIDVILT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-334517115141NO APICAL MERISTEM PROTEIN
1ut4_B4e-334517115141NO APICAL MERISTEM PROTEIN
1ut7_A4e-334517115141NO APICAL MERISTEM PROTEIN
1ut7_B4e-334517115141NO APICAL MERISTEM PROTEIN
3swm_A4e-334517118144NAC domain-containing protein 19
3swm_B4e-334517118144NAC domain-containing protein 19
3swm_C4e-334517118144NAC domain-containing protein 19
3swm_D4e-334517118144NAC domain-containing protein 19
3swp_A4e-334517118144NAC domain-containing protein 19
3swp_B4e-334517118144NAC domain-containing protein 19
3swp_C4e-334517118144NAC domain-containing protein 19
3swp_D4e-334517118144NAC domain-containing protein 19
4dul_A4e-334517115141NAC domain-containing protein 19
4dul_B4e-334517115141NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (PubMed:18443413, PubMed:24329768). Calmodulin-regulated transcriptional repressor. Binds several synthetic promoters with randomly selected binding sites (PubMed:17947243). Functions synergistically with SNI1 as negative regulator of pathogen-induced PR1 expression and basal resistance to a virulent strain of P.syringae. Binds directly to the promoter of the PR1 gene (PubMed:22826500). Acts as positive regulator of innate immunity. Involved in the effector-triggered immunity (ETI) induction of immunity-related gene expression (PubMed:24329768). Mediates osmotic stress signaling in leaf senescence by up-regulating senescence-associated genes (PubMed:18443413). {ECO:0000269|PubMed:17947243, ECO:0000269|PubMed:18443413, ECO:0000269|PubMed:22826500, ECO:0000269|PubMed:24329768}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023872460.12e-87NAC domain-containing protein 62-like
SwissprotF4JN352e-46NTL9_ARATH; Protein NTM1-like 9
TrEMBLA0A2N9EGM81e-58A0A2N9EGM8_FAGSY; Uncharacterized protein
STRINGXP_006441279.11e-47(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20652586
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35580.18e-49NAC transcription factor-like 9
Publications ? help Back to Top
  1. Zheng XY, et al.
    Spatial and temporal regulation of biosynthesis of the plant immune signal salicylic acid.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(30): p. 9166-73
    [PMID:26139525]
  2. Guo T, et al.
    Lamin-like Proteins Negatively Regulate Plant Immunity through NAC WITH TRANSMEMBRANE MOTIF1-LIKE9 and NONEXPRESSOR OF PR GENES1 in Arabidopsis thaliana.
    Mol Plant, 2017. 10(10): p. 1334-1348
    [PMID:28943325]