PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold05267-snap-gene-0.12-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family bZIP
Protein Properties Length: 330aa    MW: 36754.3 Da    PI: 9.2565
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold05267-snap-gene-0.12-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.76.9e-15260303548
                                                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                                     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                                                +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++L+ +
  maker-scaffold05267-snap-gene-0.12-mRNA-1 260 RRQKRMIKNRESAARSRARKQAYTHELENKVSRLEEENERLRRQ 303
                                                79***************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR000411.0E-5114136IPR001630cAMP response element binding (CREB) protein
Gene3DG3DSA:1.20.5.1701.1E-13254305No hitNo description
PRINTSPR000411.0E-5255271IPR001630cAMP response element binding (CREB) protein
SMARTSM003382.0E-11256328IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.714258306IPR004827Basic-leucine zipper domain
PfamPF001701.3E-12260305IPR004827Basic-leucine zipper domain
CDDcd147072.55E-25260314No hitNo description
SuperFamilySSF579591.75E-10260305No hitNo description
PROSITE patternPS000360263278IPR004827Basic-leucine zipper domain
PRINTSPR000411.0E-5273293IPR001630cAMP response element binding (CREB) protein
PRINTSPR000411.0E-5293310IPR001630cAMP response element binding (CREB) protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MGAQSVGSQG GGVSTVQMHK SQSLARQGSL YSLTLDEVHS QLGDLGKPLG SMNLDELLKT  60
VWTAEATQVP DNSNNVISGS ASGLHKQGSL TFSRDLSKKT VDEVWKDIQH KNIKYSDQER  120
NKVQEKNPTL GEITLEDFLV KAGVVTESYN NNNNNNCEKG NAAAGVLGVD SIAAPQHSHW  180
MQMQFQLPSV QQQQQNMMVL MHHPVPVQVQ QQPLPVMDAP YSDTHMTMSP TSLIGTLSDT  240
QTPGRKRGAT GEVVERTVER RQKRMIKNRE SAARSRARKQ AYTHELENKV SRLEEENERL  300
RRQKEEEKVL PTAPPPEPKY QLRRTSSAPI
Functional Description ? help Back to Top
Source Description
UniProtBinds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00409DAPTransfer from AT3G56850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC2154061e-33KC215406.1 Camellia sinensis bZIP transcription factor bZIP7 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023924204.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES31e-106AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLA0A2N9GEM71e-137A0A2N9GEM7_FAGSY; Uncharacterized protein
STRINGXP_006430421.11e-124(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF132034105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.11e-43ABA-responsive element binding protein 3
Publications ? help Back to Top
  1. Kim H, et al.
    ABA-HYPERSENSITIVE BTB/POZ PROTEIN 1 functions as a negative regulator in ABA-mediated inhibition of germination in Arabidopsis.
    Plant Mol. Biol., 2016. 90(3): p. 303-15
    [PMID:26667153]
  2. Song C,Kim T,Chung WS,Lim CO
    The Arabidopsis Phytocystatin AtCYS5 Enhances Seed Germination and Seedling Growth under Heat Stress Conditions.
    Mol. Cells, 2017. 40(8): p. 577-586
    [PMID:28756655]