PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold04981-augustus-gene-0.2-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 358aa    MW: 40445.6 Da    PI: 8.5528
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold04981-augustus-gene-0.2-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.71.9e-56161421129
                                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrd 65 
                                                   lppGfrFhPtdeel+++yL kkv ++++++ ++i evd++k+ePw+Lp k+k +ekewyfF+ rd
  maker-scaffold04981-augustus-gene-0.2-mRNA-1  16 LPPGFRFHPTDEELISHYLYKKVIDTSFSA-RAIGEVDLNKSEPWELPWKAKMGEKEWYFFCVRD 79 
                                                   79**************************99.89***************888999*********** PP

                                           NAM  66 kkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                                                   +ky+tg r+nrat++gyWkatgkdke+++ +++lvg+kktLvfykgrapkgekt+Wvmheyrle
  maker-scaffold04981-augustus-gene-0.2-mRNA-1  80 RKYPTGLRTNRATEAGYWKATGKDKEIYK-GKSLVGMKKTLVFYKGRAPKGEKTNWVMHEYRLE 142
                                                   *****************************.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-6312166IPR003441NAC domain
PROSITE profilePS5100558.8116166IPR003441NAC domain
PfamPF023651.4E-2917141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MENFSGAYKE EEQMDLPPGF RFHPTDEELI SHYLYKKVID TSFSARAIGE VDLNKSEPWE  60
LPWKAKMGEK EWYFFCVRDR KYPTGLRTNR ATEAGYWKAT GKDKEIYKGK SLVGMKKTLV  120
FYKGRAPKGE KTNWVMHEYR LEGKLSVHNL PKTARNEWVI SRIFQKTSGG KKIHISGIVR  180
MGTFGTELDP SNLPPLMDSS PYTGKTQSVS ESAYVPCFSN IMDAQRNQEG MMNSFNSSLS  240
GVSSYQTDIL PRIPISSSFY SAQTIPLSAN QQFPGSVAMQ DHSILRALLG NQGSNLRQSF  300
KTEREMLNVS HETAMTTDMN AEISSGVSNL EIGRRPFDNQ EVPSTSAGPV DFDNLWSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A9e-551317217174NAC domain-containing protein 19
3swm_B9e-551317217174NAC domain-containing protein 19
3swm_C9e-551317217174NAC domain-containing protein 19
3swm_D9e-551317217174NAC domain-containing protein 19
3swp_A9e-551317217174NAC domain-containing protein 19
3swp_B9e-551317217174NAC domain-containing protein 19
3swp_C9e-551317217174NAC domain-containing protein 19
3swp_D9e-551317217174NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023894361.10.0NAC domain-containing protein 100-like
SwissprotQ9FLJ21e-171NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A2N9ERU10.0A0A2N9ERU1_FAGSY; Uncharacterized protein
STRINGcassava4.1_010528m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-169NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]