PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold04858-snap-gene-0.9-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family WRKY
Protein Properties Length: 181aa    MW: 21120.7 Da    PI: 9.7174
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold04858-snap-gene-0.9-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.84.7e-33102160159
                                               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                                      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                               ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ +v++tYeg H+h+
  maker-scaffold04858-snap-gene-0.9-mRNA-1 102 LDDGYRWRKYGQKAVKNNKFPRSYYRCTYQGCNVKKQVQRLTKDEAIVVTTYEGMHTHQ 160
                                               59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.3E-3587160IPR003657WRKY domain
SuperFamilySSF1182901.03E-2994161IPR003657WRKY domain
PROSITE profilePS5081129.56297162IPR003657WRKY domain
SMARTSM007744.2E-39102161IPR003657WRKY domain
PfamPF031068.8E-27103160IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MENYQMFFPC SSTGQSTYPF STNMESSNAY HNLHGESSKG FIGLGAENHH VPRDEVNKQL  60
SQRTESFARD GSDEVKPSKK KGEKKIRKPR FAFQTRSQVD ILDDGYRWRK YGQKAVKNNK  120
FPRSYYRCTY QGCNVKKQVQ RLTKDEAIVV TTYEGMHTHQ IEKPTDNFEH ILSQMQIYTP  180
F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-2892161776Probable WRKY transcription factor 4
2lex_A2e-2892161776Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015869717.19e-83PREDICTED: probable WRKY transcription factor 75
RefseqXP_015871944.19e-83PREDICTED: probable WRKY transcription factor 75
SwissprotQ9FYA24e-56WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLB9GF444e-82B9GF44_POPTR; Uncharacterized protein
STRINGPOPTR_0001s33560.11e-81(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.13e-57WRKY DNA-binding protein 75