PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold04662-augustus-gene-0.23-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family LBD
Protein Properties Length: 242aa    MW: 24884.3 Da    PI: 8.0851
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold04662-augustus-gene-0.23-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.81.2e-40291291100
                                         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeq.pkkfanvhklFGasnvlkllkalpeeeredamsslvy 63 
                                                    +C aCk+lrrkC+++C++apyf +eq + +fa+vhk+FGasnv+kll ++p ++r da+ +++y
  maker-scaffold04662-augustus-gene-0.23-mRNA-1  29 PCGACKFLRRKCVPGCIFAPYFDSEQgAGHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTICY 92 
                                                    7***********************9988************************************ PP

                                         DUF260  64 eAearardPvyGavgvilklqqqleqlkaelallkee 100
                                                    eA+ar+rdPvyG+v++i++lqqq+ +l+ael++l+++
  maker-scaffold04662-augustus-gene-0.23-mRNA-1  93 EAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAH 129
                                                    ********************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.96128130IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-3929127IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010089Biological Processxylem development
GO:0010311Biological Processlateral root formation
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MSVNPTSSGG SGGGGGSSGS GGGGGGGGPC GACKFLRRKC VPGCIFAPYF DSEQGAGHFA  60
AVHKVFGASN VSKLLLHIPV HKRLDAVVTI CYEAQARLRD PVYGCVAHIF ALQQQVVNLQ  120
AELSYLQAHL ATLELPSPLP PHPPPPPTMM TPPPLSIADL PSASSVPATF DLSSLFDPMV  180
QPSWPMQQRP MDPRQLGGSG TSSSAGGGDL QALARELLHR HGTPSPGSVP CSSPSPSQSF  240
SK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00314DAPTransfer from AT2G45420Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012475250.11e-118PREDICTED: LOB domain-containing protein 18
SwissprotO221314e-83LBD18_ARATH; LOB domain-containing protein 18
TrEMBLA0A0D2MZ411e-118A0A0D2MZ41_G
STRINGVIT_15s0048g00830.t011e-106(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17713493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45420.11e-78LOB domain-containing protein 18