PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold04568-augustus-gene-0.12-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family HD-ZIP
Protein Properties Length: 323aa    MW: 36755.9 Da    PI: 7.1428
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold04568-augustus-gene-0.12-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.13.1e-1877129456
                                                    -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                                       Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                                    + +++ eq+++Le+ Fe  +++  e++ +LAk lgL+ rq+ +WFqNrRa++k
  maker-scaffold04568-augustus-gene-0.12-mRNA-1  77 KKRLSLEQVKALEKSFEIGNKLEPERKMHLAKALGLQPRQIAIWFQNRRARWK 129
                                                    556899**********************************************9 PP

2HD-ZIP_I/II129.71.2e-4175165191
                                    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdye 64 
                                                    ekk+rls eqvk+LE+sFe  +kLeperK++la++Lglqprq+a+WFqnrRAR+ktkqlEkdye
  maker-scaffold04568-augustus-gene-0.12-mRNA-1  75 EKKKRLSLEQVKALEKSFEIGNKLEPERKMHLAKALGLQPRQIAIWFQNRRARWKTKQLEKDYE 138
                                                    69************************************************************** PP

                                    HD-ZIP_I/II  65 aLkraydalkeenerLekeveeLreel 91 
                                                    +Lk++++alk++n++L++++++L++e+
  maker-scaffold04568-augustus-gene-0.12-mRNA-1 139 VLKKQFEALKADNDNLQTQNKKLTAEV 165
                                                    ***********************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.78E-1969133IPR009057Homeodomain-like
PROSITE profilePS5007116.89271131IPR001356Homeobox domain
SMARTSM003891.7E-1874135IPR001356Homeobox domain
CDDcd000862.86E-1776132No hitNo description
PfamPF000462.2E-1577129IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.7E-1978138IPR009057Homeodomain-like
PRINTSPR000313.5E-5102111IPR000047Helix-turn-helix motif
PROSITE patternPS000270106129IPR017970Homeobox, conserved site
PRINTSPR000313.5E-5111127IPR000047Helix-turn-helix motif
PfamPF021839.7E-14131165IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MAFPTSHGFM FQTHEDQDHL PSSNTFPSCP PQHYHGAVPF MMKRSMSFSG IDNNKCEEVV  60
HGDDELSDDG SQLGEKKKRL SLEQVKALEK SFEIGNKLEP ERKMHLAKAL GLQPRQIAIW  120
FQNRRARWKT KQLEKDYEVL KKQFEALKAD NDNLQTQNKK LTAEVIVSIP TGPNGFSLAS  180
LFIYLNRMLI KYSHSDLLLL RLDLIAFIVM LQLLALKNRD TNEVGVKCIK KEAEGSWSNG  240
SENSCDINLD ISRTPVMNSP VSSQLSSHHL FPSSLRPTSM TQLLQGSSRP DLQSLKIDHM  300
AQDESLCNMF TGIEDQHNFW PWP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1123131RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00322DAPTransfer from AT3G01220Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023929196.10.0homeobox-leucine zipper protein HAT7-like
TrEMBLA0A2N9I4L21e-162A0A2N9I4L2_FAGSY; Uncharacterized protein
STRINGEOY034141e-136(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01220.12e-79homeobox protein 20