PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold04550-snap-gene-0.25-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 276aa    MW: 31837.3 Da    PI: 4.351
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold04550-snap-gene-0.25-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM123.32.1e-381082342128
                                        NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikev.diykvePwdLp.kkvkaeekewyfFskrdkk 67 
                                                 pG+ F P+d  l+v+yL +kv + +l++ ++++++ ++y+++P+ +  +  +  ek wyfF++r++k
  maker-scaffold04550-snap-gene-0.25-mRNA-1 108 IPGCMFCPSDYILIVHYLINKVLNYPLPC-DFVEDAeELYNHNPELIAeQYGNRAEKAWYFFAPRKQK 174
                                                69***************************.77888779*********8344455777*********** PP

                                        NAM  68 yatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                                y++ kr+nr++ +gyWka g dk+++s ++ ++g k+ Lvfy+g+ p+g kt+W+mheyr+
  maker-scaffold04550-snap-gene-0.25-mRNA-1 175 YQNRKRPNRVAGNGYWKAMGADKAIKS-REIVIGHKRKLVFYEGEPPSGDKTNWIMHEYRI 234
                                                ***************************.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.98E-44103243IPR003441NAC domain
PROSITE profilePS5100540.284107261IPR003441NAC domain
PfamPF023651.4E-20109234IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MCIPLEISSE SDHDSDHTNN YESESPTSPL YSPSRDTSFS SSPSGTFYFD DDEGEESDEE  60
EEEEEPDEEE GNQSLEEVDV SVLKAFLNDK LHQLGEEPQM EYPKLDIIPG CMFCPSDYIL  120
IVHYLINKVL NYPLPCDFVE DAEELYNHNP ELIAEQYGNR AEKAWYFFAP RKQKYQNRKR  180
PNRVAGNGYW KAMGADKAIK SREIVIGHKR KLVFYEGEPP SGDKTNWIMH EYRIDHPITE  240
NDMRALSEKC EKLILSQISV GSFQMRKRPC EGLLAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-3510425814162NO APICAL MERISTEM PROTEIN
1ut4_B3e-3510425814162NO APICAL MERISTEM PROTEIN
1ut7_A3e-3510425814162NO APICAL MERISTEM PROTEIN
1ut7_B3e-3510425814162NO APICAL MERISTEM PROTEIN
3swm_A3e-3510425817165NAC domain-containing protein 19
3swm_B3e-3510425817165NAC domain-containing protein 19
3swm_C3e-3510425817165NAC domain-containing protein 19
3swm_D3e-3510425817165NAC domain-containing protein 19
3swp_A3e-3510425817165NAC domain-containing protein 19
3swp_B3e-3510425817165NAC domain-containing protein 19
3swp_C3e-3510425817165NAC domain-containing protein 19
3swp_D3e-3510425817165NAC domain-containing protein 19
4dul_A3e-3510425814162NAC domain-containing protein 19
4dul_B3e-3510425814162NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023912167.11e-129NAC transcription factor 32-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101121642
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-36NAC-like, activated by AP3/PI