PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold04550-snap-gene-0.24-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 607aa    MW: 70170.1 Da    PI: 5.6264
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold04550-snap-gene-0.24-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM131.46.5e-411252522128
                                        NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkk 67 
                                                ppG++F+Ptd +l++ yL kk  + +l+  + i +v++y++ P+ L +  + + e++e+yfF++r +k
  maker-scaffold04550-snap-gene-0.24-mRNA-1 125 PPGYKFNPTDFDLIMSYLIKKYLNIPLPW-NSIVDVELYNHSPEWLAEeyRKYDEQEELYFFTPRYRK 191
                                                89***************************.78**************8523334466799********* PP

                                        NAM  68 yatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                                y++gkr+ ra+ +gyWkatg dke+ s+kg +vg kktLvfy+g+ap+g kt+W+m ey++
  maker-scaffold04550-snap-gene-0.24-mRNA-1 192 YPNGKRPDRAAGDGYWKATGADKEIESNKGITVGYKKTLVFYRGKAPSGDKTNWIMYEYKI 252
                                                ***********************************************************86 PP

2NAM140.11.4e-433434692128
                                        NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkky 68 
                                                ppG++F+P++ el+ +yLk+k+ g++l+  + i +v++y++ P+ L  +  + +++ewyfF++r++ky
  maker-scaffold04550-snap-gene-0.24-mRNA-1 343 PPGYKFDPSEFELIIFYLKRKILGEHLPW-NKIMDVELYNHSPEWLTeQYPQYGKNEWYFFTPRERKY 409
                                                89***************************.77**************8455566889************ PP

                                        NAM  69 atgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                                ++g r+nra+ +g+Wkatg dk+++sk++ l+g +k Lvfy+g+ pkgekt+W+mheyr+
  maker-scaffold04550-snap-gene-0.24-mRNA-1 410 KNGVRPNRAAGDGFWKATGADKKIKSKTEILIGFRKALVFYRGKPPKGEKTNWIMHEYRI 469
                                                **********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.27E-46119275IPR003441NAC domain
PROSITE profilePS5100545.901124278IPR003441NAC domain
PfamPF023658.8E-20125252IPR003441NAC domain
SuperFamilySSF1019411.57E-52334495IPR003441NAC domain
PROSITE profilePS5100550.438342495IPR003441NAC domain
PfamPF023652.6E-23343469IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 607 aa     Download sequence    Send to blast
MESNHDHQQS KPIMANHNRQ NNNPSLMAPG ITNQVMISNI NPTTQSPQAL NVPRSSTSTY  60
SSPPSVVIDP PEPSLDDEEE QEEEPNQQSE EVDELGLERI LNKLLLEYDD EPEKQYHNFD  120
NVHPPPGYKF NPTDFDLIMS YLIKKYLNIP LPWNSIVDVE LYNHSPEWLA EEYRKYDEQE  180
ELYFFTPRYR KYPNGKRPDR AAGDGYWKAT GADKEIESNK GITVGYKKTL VFYRGKAPSG  240
DKTNWIMYEY KIKHPPLTRS SENDMRLDKW VLCNAIHNIN NATESPRSNE SDSVVDADDD  300
QEQGEELQDE EEVAVNSGSI QDLIQLDDNP NMNYCSFDTL DPPPGYKFDP SEFELIIFYL  360
KRKILGEHLP WNKIMDVELY NHSPEWLTEQ YPQYGKNEWY FFTPRERKYK NGVRPNRAAG  420
DGFWKATGAD KKIKSKTEIL IGFRKALVFY RGKPPKGEKT NWIMHEYRIN HPPLTKRNPD  480
DMRLDKWVLC KIYWKSESNK SSKPQQSQNE ICSTSSQDGD RKARNGAMIN QSHQNVPNLD  540
HMSSRMANHF QPMGCNNYGP PHRAHMPSRF SNEIQALAGN HGNPPQAPSF PTQLQPMATD  600
YGTLPQK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-4512549815169NO APICAL MERISTEM PROTEIN
1ut4_B2e-4512549815169NO APICAL MERISTEM PROTEIN
1ut7_A2e-4512549815169NO APICAL MERISTEM PROTEIN
1ut7_B2e-4512549815169NO APICAL MERISTEM PROTEIN
3swm_A2e-4512549818172NAC domain-containing protein 19
3swm_B2e-4512549818172NAC domain-containing protein 19
3swm_C2e-4512549818172NAC domain-containing protein 19
3swm_D2e-4512549818172NAC domain-containing protein 19
3swp_A2e-4512549818172NAC domain-containing protein 19
3swp_B2e-4512549818172NAC domain-containing protein 19
3swp_C2e-4512549818172NAC domain-containing protein 19
3swp_D2e-4512549818172NAC domain-containing protein 19
4dul_A2e-4512549815169NAC domain-containing protein 19
4dul_B2e-4512549815169NAC domain-containing protein 19
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023912168.17e-94NAC transcription factor 25-like
TrEMBLA0A3S3PTQ01e-101A0A3S3PTQ0_9MAGN; NAC domain-containing protein 45
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101121642
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-50NAC-like, activated by AP3/PI